CAZyme Information: MGYG000003572_00620

Basic Information

• Species: Prevotella sp900770025
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900770025
• CAZyme ID: MGYG000003572_00620
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1085		124086.36	7.3061

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003572	2050564	MAG	Fiji	Oceania

• Gene Location: Start: 22126; End: 25383 Strand: -

Full Sequence      

MKESSTMKYHIRIRTHHTPHTSCTAWIRAMVCLTFIFSVFSRIQGHENEQHDWENQYMLS
ANRLPARASYIPYLNQPGDRTLSLDGTWRFHWTATPDAQPADFYKVGHDDSNWDYMTVPG
DWEMNGYGTPIYSSSGYTFKIQPPFVMKEPKKKYTSYTERNPTGCYRRTFELPADWEGKE
VYIHFGSVASAFYVYVNGQKVGYSQGSMEPAEFRLTPYLHKGTNLIAMKVMKYSDGSYLE
DQDMWRIAGIHRSIYLYATPRIRIDDLGVRTLLDEACKDAILVIDPHLSVTEGQRGEGFH
VEAMLYDAEGKAVLDKTLQQEAVTMLNLDNKGKIMNERNPQRGYAPYGWMKTAIKNPKKW
SAETPYLYTLKVSLKDSTQQTVERVEIKVGFRKLEIDNGRFLVNGKQVRLRGVNRHEMDP
LTGKVTTEEQMMKDIRLLKQCNINAVRTCHYPNCSRWYELCDEYGIYVMDEADIEEHGLR
GKLASEASWAAAFIDRTQRMAVRDRNHACVIFWSLGNESGWGPNFAATGAWLKEYDPTRF
IHYEGAQGPDSKDPSTVDVISRFYPRVKQEYLNPGVKDSNMERPENARWERLLEIAEKKN
DNRPVLTSEYAHAMGNALGNFKDYWDEIYSNPRMLGGFIWEWADEGIFKKRTDGKTMVAY
GGDFNDVPNLGAFCVKGIVTSDRQITPKYEEVKQVYAPFRPIWKNETLLFRKLDEHACHN
RYMIAWNITRNGKTTAHGEAMMTESTNTDAQGYALHPIDVQGGSKLQKAITRIQKGPNDD
VRLNVSLVLREDLPWASKGHEVCNGQFVLNDALATAFKAKPLKKGKRINEETALAWIEQI
QPRFYHAPTDNDRGFGNWMAKDWSNNLLDKPTLENAIAPNAITNEDGTVTVSATTIHKYL
RGSICTNYQYTMDHEGNVDLHVSFTPEGELPPLPCVGITMTLPATYNRLQYYGMGPSDNY
PDRQEAASIGMWQSTVEQQYVHYPRPQMSGNHEKVAMLQLTDNKGKGWIITNGSDAPFSF
SVLPYSTRQLCTVKHDCDLETEPYTYLHINAVVMGLGNSSCGPGVLMRYSVKQQPYSLHL
QFRKK

Enzyme Prediction     

No EC number prediction in MGYG000003572_00620.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	75	969	1.4e-208	0.9680851063829787

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09525	lacZ	0.0	50	1057	14	998	beta-galactosidase.
PRK10340	ebgA	0.0	53	1082	4	997	cryptic beta-D-galactosidase subunit alpha; Reviewed
COG3250	LacZ	6.87e-153	73	970	4	807	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam02836	Glyco_hydro_2_C	3.43e-98	395	699	2	300	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
smart01038	Bgal_small_N	8.11e-72	836	1083	26	271	Beta galactosidase small chain. This domain comprises the small chain of dimeric beta-galactosidases EC:3.2.1.23. This domain is also found in single chain beta-galactosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SCD21479.1	0.0	50	1079	23	1075
QEW37240.1	0.0	51	1082	22	1052
QUT58526.1	0.0	51	1082	22	1052
QQY43475.1	0.0	51	1082	22	1052
QUT83720.1	0.0	51	1082	22	1059

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6S6Z_A	3.83e-216	51	1083	2	980	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
6SD0_A	3.94e-216	51	1083	3	981	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
3DEC_A	7.95e-176	49	1071	3	983	ChainA, Beta-galactosidase [Bacteroides thetaiotaomicron VPI-5482]
3BGA_A	1.95e-171	52	1080	9	998	Crystalstructure of beta-galactosidase from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],3BGA_B Crystal structure of beta-galactosidase from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482]
3MUY_1	2.40e-168	49	1085	12	1023	Chain1, Beta-D-galactosidase [Escherichia coli K-12],3MUY_2 Chain 2, Beta-D-galactosidase [Escherichia coli K-12],3MUY_3 Chain 3, Beta-D-galactosidase [Escherichia coli K-12],3MUY_4 Chain 4, Beta-D-galactosidase [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56307	2.16e-215	51	1083	3	981	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
A5F5U6	1.68e-187	52	1085	12	1019	Beta-galactosidase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) OX=345073 GN=lacZ PE=3 SV=2
O52847	4.29e-183	48	1057	15	1004	Beta-galactosidase OS=Priestia megaterium (strain DSM 319 / IMG 1521) OX=592022 GN=bgaM PE=3 SV=1
Q6LL68	3.19e-181	49	1083	8	1026	Beta-galactosidase OS=Photobacterium profundum (strain SS9) OX=298386 GN=lacZ PE=3 SV=1
Q7MG04	4.97e-180	49	1083	9	1027	Beta-galactosidase OS=Vibrio vulnificus (strain YJ016) OX=196600 GN=lacZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.621120	0.367592	0.007853	0.000880	0.000712	0.001858

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003572_00620.