CAZyme Information: MGYG000003572_01379

Basic Information

• Species: Prevotella sp900770025
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900770025
• CAZyme ID: MGYG000003572_01379
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
322	MGYG000003572_75|CGC1	36585.38	8.2332

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003572	2050564	MAG	Fiji	Oceania

• Gene Location: Start: 12793; End: 13761 Strand: +

Full Sequence      

MKKITLLLLAVLATITAQAASKYDNPDTLVVARDGTGEFRNIDDALEVCRAYMDYHKVIF
VKKGTYKEKLIVSGWLTNIEILGEDRDNTIITYDDHANISIPQRPKGMGTFRTYTVRVDG
NDITFKNITIENNSARLGQAVALHTNGDRLRFINCRLLGHQDTVLTAGEGFRVYFLDCYI
EGTTDFIFGPATAWFEHCTIHSKANSYITAASTPAASPYGYVFHNCDLTADSNVTKVYLG
RPWRDYAYTLFINCNLGKHIRHEGWHHWEKHREQTARYGEYNNRGEGAATDKRAGWSKQL
TKKEAALITLDNVFKRETVWKP

Enzyme Prediction     

No EC number prediction in MGYG000003572_01379.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	29	314	4.9e-99	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01095	Pectinesterase	3.09e-69	30	312	3	293	Pectinesterase.
PLN02773	PLN02773	3.40e-68	29	306	7	288	pectinesterase
COG4677	PemB	4.65e-62	26	315	80	403	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
PLN02432	PLN02432	1.66e-59	29	306	13	278	putative pectinesterase
PLN02682	PLN02682	5.59e-54	28	305	70	352	pectinesterase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QVJ81978.1	3.27e-169	1	322	1	322
ADE82952.1	3.27e-169	1	322	1	322
BCS84477.1	3.83e-164	1	322	1	323
AGB28242.1	2.25e-153	1	322	1	323
QJR97878.1	2.41e-149	20	322	13	318

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GQ8_A	1.83e-38	29	296	9	281	Pectinmethylesterase from Carrot [Daucus carota]
1XG2_A	2.57e-37	30	296	6	277	ChainA, Pectinesterase 1 [Solanum lycopersicum]
5C1E_A	3.35e-37	29	293	11	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	1.80e-36	29	293	11	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
2NSP_A	6.11e-25	58	313	36	333	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	1.23e-48	31	305	9	287	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q5MFV6	1.24e-45	28	298	276	554	Probable pectinesterase/pectinesterase inhibitor VGDH2 OS=Arabidopsis thaliana OX=3702 GN=VGDH2 PE=2 SV=2
P41510	8.20e-44	28	298	272	550	Probable pectinesterase/pectinesterase inhibitor OS=Brassica napus OX=3708 GN=BP19 PE=2 SV=1
Q43062	9.45e-44	30	296	210	482	Pectinesterase/pectinesterase inhibitor PPE8B OS=Prunus persica OX=3760 PE=2 SV=1
Q43043	1.25e-43	31	296	61	332	Pectinesterase OS=Petunia integrifolia OX=4103 GN=PPE1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000275	0.999047	0.000171	0.000168	0.000160	0.000149

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003572_01379.