CAZyme Information: MGYG000003573_00347

Basic Information

• Species: RC9 sp900769905
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp900769905
• CAZyme ID: MGYG000003573_00347
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
814	MGYG000003573_39|CGC2	92097.11	4.9506

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003573	2177308	MAG	Fiji	Oceania

• Gene Location: Start: 35311; End: 37755 Strand: +

Full Sequence      

MKCHLKTLILLLSLSFFTNISLYANSPDYALFEDGPGRTAIAGPDFIAGIVTDKAHEWEG
VLWAAENLSEDFGRVTGRKAPLTPVASGPSIIVGTIGRGGKIDSYLSAEELASLDGAVEK
YLLKTLDGNVIIAGSDKRGTTYGIYALSSSIGVSPWYWWADVPSEHHEYIYIKDGCFTEG
EPKVTYRGIFLNDEAPALTGWVNENTHGYKSGFYKKVFELLLRLKGNFMWPAMWDAAFYD
DDPLNMYYADTMGIIMGTSHHEPCARAQKEWHRYGNGIWDYNKNRKVLEDFWSKGIERMK
DTEDVVTIGMRGDGDMAMEEGTNIALLEKIITNQRKLISRVTGKPASETPQVWALYKEVQ
DYYDKGMRVPDDVTLLLCDDNWGNVRKLPSLDEKPRKGGYGMYYHFDYVGGPRNYKWLNC
NQVERVWEQMNLCWEYGVRKLWVVNVGDLKPMEYPIQFFLDMAWDPESITPDTIHEHTVK
FAADQFGQEQAAEIADIIRLYSKYARRVTPELLNSRTYSFAYDEWPTVLREWNDLETRAL
RVLQKLDAEQWDAYGELVLFPVQAMQNVYEMYYSAAMNAAASTPQDINYWADRVEKLYER
DSLLCAHYNHEIAGGKWNHMMDQTHIGYTYWQQPRKQVMPKVSRSGEEAYLCHKEDGGYL
SIEAGNFSDSRGVSVIPDLGKTQCGLTTLPAAQTPQDAWVEYSVLTESDGKAKLSILLAP
TLNFNAGAGLRYAVSVDGGEEVIVNYNGHYKGELGPWQAASIIPSEAELDFGKAGRHSLR
FRFVDAGVVLEKIMVDFGGLQRSYLGAPSSELIK

Enzyme Prediction     

EC	3.2.1.131

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	49	793	2.5e-263	0.9799139167862266

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	0.0	180	512	1	334	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	3.26e-44	655	808	4	171	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.
pfam03648	Glyco_hydro_67N	4.62e-06	28	147	4	120	Glycosyl hydrolase family 67 N-terminus. Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the N-terminal region of alpha-glucuronidase. The N-terminal domain forms a two-layer sandwich, each layer being formed by a beta sheet of five strands. A further two helices form part of the interface with the central, catalytic, module (pfam07488).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRQ48268.1	0.0	57	814	52	819
QUT46125.1	0.0	57	814	52	819
QRQ50209.1	0.0	55	814	50	819
QIU93956.1	0.0	55	810	48	820
CCO21037.1	0.0	47	813	1	788

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C90_A	3.01e-249	57	805	61	844	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
7PUG_A	1.02e-243	33	805	11	829	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PXQ_A	5.11e-241	33	805	10	828	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
4ZMH_A	2.60e-187	37	643	12	632	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
6NPS_A	8.56e-117	60	633	31	647	Crystalstructure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112],6NPS_B Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000403	0.998847	0.000242	0.000169	0.000164	0.000157

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003573_00347.