CAZyme Information: MGYG000003573_00498

Basic Information

• Species: RC9 sp900769905
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp900769905
• CAZyme ID: MGYG000003573_00498
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
380	MGYG000003573_57|CGC2	42590.86	7.7077

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003573	2177308	MAG	Fiji	Oceania

• Gene Location: Start: 26579; End: 27721 Strand: -

Full Sequence      

MRYYLIAGEASGDLHGSNLIKGLVQEDPASEFRYWGGDLMDSAASSRPHSLVRHYKEGAV
MGAAEVLAKAGKLLGNLKFCKKDILEWKPDVVILIDYPGFNMKIAKFCHSRDIRCFYYIA
PKTWASREGRNRKLKAWVDRLFIVFPFEKEYFKSRGIPYEYEGNPLVDAIDSHEFKPVQD
GDYIAVLAGSRKAEISRMMPVCMEAADRLHALPQYAGMRFVVAGAPARDASDYAPYIGNR
DYVSVVFGRTYDILSYARAAVINSGTASLEAALIATPQVVGWNTSALTYFLGKYVLRVLD
HIKYISLGNLCLDKLAFREMLQNDFNAEALADELRRLMEDSRYRETMLSDYAAIRESLGG
EGASRKVAARMVSILSGTED

Enzyme Prediction     

No EC number prediction in MGYG000003573_00498.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	358	3.8e-99	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	2.89e-96	1	368	2	368	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.23e-95	1	377	2	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	2.93e-70	4	366	2	366	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	3.45e-57	5	371	10	383	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	1.91e-46	56	374	46	347	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS97897.1	5.89e-111	1	375	1	370
ALR31450.1	1.24e-106	1	368	1	361
BAX81022.1	2.28e-106	1	368	1	366
QIY84733.1	2.58e-106	1	374	1	367
AZI39159.1	5.69e-106	1	376	1	369

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	6.80e-33	5	358	11	365	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	6.80e-33	5	358	11	365	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q39T49	5.06e-67	2	375	8	380	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
B3E4H8	1.51e-65	2	375	8	380	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
Q74AT9	3.38e-64	2	375	8	380	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
Q2LVL8	5.07e-63	5	375	8	378	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q1D393	1.00e-62	2	375	6	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003573_00498.