CAZyme Information: MGYG000003574_00903

Basic Information

• Species: CAG-110 sp900770015
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; CAG-110; CAG-110 sp900770015
• CAZyme ID: MGYG000003574_00903
• CAZy Family: GH1
• CAZyme Description: 1,4-beta-D-glucan glucohydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
427	MGYG000003574_180|CGC1	48569.07	5.3449

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003574	3049750	MAG	Fiji	Oceania

• Gene Location: Start: 3574; End: 4857 Strand: +

Full Sequence      

MSKFPKGFFVGAATAAHQVEGNNTKSDCWAQEQMPHSTYKEKSGIACDHYNRYQEDIQLM
KKAGLNAYRFSIEWARIQPEEGVFDDEQIEHYRKVIRCCRENGIEPIVTLFHFSSPVWII
RKGGWEAETVVEDFEKYVTHVIRALGSELKYVCTINEANMGLQVAAISRRYTMMAKKAAE
AAAKNGGGEVQMGLNMQAMMENMKYQAMENAEIFGTPQPHCFNLGGSEHSDQLTMKCHQA
AKKVIKALYPDIQVGLTLSLHDLQPVEGGEARAEETWAEEFTHYLPYIQGDDFLGVQNYT
RTLVGAEEDLPVPDGAERTQMGYEYYPEALEHVIRAVAKDFKGNLMVTENGVSCDDDFRR
VNFINIATDGVARCIADGIPVKGYFYWSLMDNFEWQMGYRMRFGLISVNRETMERTPKES
LYHLGRL

Enzyme Prediction     

EC	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	2	424	5e-117	0.972027972027972

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR03356	BGL	7.94e-96	5	420	1	422	beta-galactosidase.
COG2723	BglB	3.47e-88	1	422	1	444	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
pfam00232	Glyco_hydro_1	2.40e-81	4	422	5	442	Glycosyl hydrolase family 1.
PRK13511	PRK13511	1.28e-49	1	422	2	457	6-phospho-beta-galactosidase; Provisional
PLN02849	PLN02849	3.23e-41	2	422	28	474	beta-glucosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQD66451.1	9.23e-264	1	427	1	428
QQA37083.1	1.78e-261	1	427	1	428
AXB29242.1	2.53e-222	1	425	1	428
AHF24559.1	3.80e-220	4	427	3	436
QTE67958.1	1.04e-216	4	426	3	424

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4R27_A	4.94e-115	4	425	7	406	Crystalstructure of beta-glycosidase BGL167 [Microbacterium sp. Gsoil167],4R27_B Crystal structure of beta-glycosidase BGL167 [Microbacterium sp. Gsoil167]
6IER_A	4.35e-93	7	427	35	427	Apostructure of a beta-glucosidase 1317 [uncultured bacterium]
6Z1H_A	1.03e-69	3	422	10	439	ChainA, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1H_B Chain B, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1M_A Chain A, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_B Chain B, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_C Chain C, Ancestral reconstructed glycosidase [synthetic construct]
1VFF_A	3.13e-69	3	427	4	402	beta-glycosidasefrom Pyrococcus horikoshii [Pyrococcus horikoshii]
5IDI_A	1.51e-55	1	422	1	431	Structureof beta glucosidase 1A from Thermotoga neapolitana, mutant E349A [Thermotoga neapolitana],5IDI_B Structure of beta glucosidase 1A from Thermotoga neapolitana, mutant E349A [Thermotoga neapolitana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B9K7M5	3.52e-55	1	422	1	431	1,4-beta-D-glucan glucohydrolase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E) OX=309803 GN=gghA PE=1 SV=2
P10482	2.41e-54	4	422	5	445	Beta-glucosidase A OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=bglA PE=3 SV=1
P0C946	9.18e-54	1	415	1	424	1,4-beta-D-glucan glucohydrolase (Fragment) OS=Thermotoga neapolitana OX=2337 GN=bglA PE=3 SV=1
Q08638	1.05e-53	1	422	3	433	Beta-glucosidase A OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=bglA PE=1 SV=1
Q03506	1.61e-53	4	422	6	437	Beta-glucosidase OS=Niallia circulans OX=1397 GN=bglA PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000026	0.000044	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003574_00903.