CAZyme Information: MGYG000003574_01040

Basic Information

• Species: CAG-110 sp900770015
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; CAG-110; CAG-110 sp900770015
• CAZyme ID: MGYG000003574_01040
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
605	MGYG000003574_196|CGC2	68404.85	4.9332

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003574	3049750	MAG	Fiji	Oceania

• Gene Location: Start: 34519; End: 36336 Strand: -

Full Sequence      

MNILFVTSECAPFSKSGGLADVAFSLPPQLKKLGHEIAVITPLYQCVRERFGDQLNKKTE
LSVWLNGAAYPCGLYWTELNGVTVWFLENEAFFHRPRLYGYDDDKKRFAWFCRAVIETLF
QLDFMPQILHCNDWETALAILYIKNDQAWRKDLKGIKTVYTIHNIAYQGQFGANELADTF
GLPWGWYDGGLGYVYEGRQDVNLMKGAMLMADAVSTVSPTYARELHRAEFGCGLQGVVDL
VDNKLYGILNGIDMEHYDPASDPRLPRHFSADDLSGKETCKASIQEKFGLTPEPRWPLFA
VVARLVEQKGIDLIREILPDLMDMGIQLIIFGQGDETYTQYFRQCAARYPGQLGFSSDYT
ERMASEIFAGADFYLMTSRFEPCGLSQMMAMCCGTVPIVHETGGLKDSVRPYSRFDGIGD
GFSFSDYQSKDLLLAIQEALKAYFADEKTFTLLRKRCMQKDFSWLRSAEEYTRMYARIAD
DAAGDAVPFEDAYAQLRDAFIALDRENRVRYQDRIDPNYHRVIQFHITGRTDGVLHVSFS
NGELEVFPAACDSADAYITAAFDQLLNMANGTISFDRLFLTGQLKVEGNLSKGAEIRQLL
GKTGI

Enzyme Prediction     

No EC number prediction in MGYG000003574_01040.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	2	476	7.2e-170	0.9957627118644068

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02095	glgA	0.0	1	478	1	473	glycogen/starch synthase, ADP-glucose type. This family consists of glycogen (or starch) synthases that use ADP-glucose (EC 2.4.1.21), rather than UDP-glucose (EC 2.4.1.11) as in animals, as the glucose donor. This enzyme is found in bacteria and plants. Whether the name given is glycogen synthase or starch synthase depends on context, and therefore on substrate. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
PRK00654	glgA	0.0	1	479	1	464	glycogen synthase GlgA.
cd03791	GT5_Glycogen_synthase_DULL1-like	0.0	2	477	1	474	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
COG0297	GlgA	1.07e-169	1	480	1	480	Glycogen synthase [Carbohydrate transport and metabolism].
PRK14099	PRK14099	1.19e-104	1	480	4	481	glycogen synthase GlgA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNL45767.1	1.16e-161	2	478	22	495
QUO39419.1	4.98e-161	1	494	1	495
BCK84472.1	7.87e-158	1	478	1	475
QCI58885.1	2.23e-154	1	478	1	475
BAL00800.1	2.91e-150	1	492	1	492

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GNE_A	8.72e-86	1	488	10	505	Catalyticdomain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana],6GNE_B Catalytic domain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana]
3D1J_A	1.67e-83	1	478	1	476	ChainA, Glycogen synthase [Escherichia coli]
2QZS_A	4.10e-83	1	478	1	476	CrystalStructure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSb) [Escherichia coli],2R4T_A Crystal Structure of Wild-type E.coli GS in Complex with ADP and Glucose(wtGSc) [Escherichia coli],2R4U_A Crystal Structure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSd) [Escherichia coli],3GUH_A Crystal Structure of Wild-type E.coli GS in complex with ADP and DGM [Escherichia coli K-12]
4HLN_A	3.08e-82	2	475	126	622	Structureof barley starch synthase I in complex with maltooligosaccharide [Hordeum vulgare]
3COP_A	3.13e-82	1	478	1	476	ChainA, Glycogen synthase [Escherichia coli],3CX4_A Chain A, Glycogen synthase [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5FL65	2.74e-127	1	478	1	474	Glycogen synthase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) OX=272621 GN=glgA PE=3 SV=1
A3CM04	1.09e-126	1	475	1	472	Glycogen synthase OS=Streptococcus sanguinis (strain SK36) OX=388919 GN=glgA PE=3 SV=1
B8ZPW5	1.13e-126	1	475	1	472	Glycogen synthase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) OX=561276 GN=glgA PE=3 SV=1
A8AYH0	6.14e-126	1	475	1	472	Glycogen synthase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288) OX=467705 GN=glgA PE=3 SV=1
B2IPY4	6.34e-126	1	475	1	472	Glycogen synthase OS=Streptococcus pneumoniae (strain CGSP14) OX=516950 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003574_01040.