CAZyme Information: MGYG000003574_02006

Basic Information

• Species: CAG-110 sp900770015
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; CAG-110; CAG-110 sp900770015
• CAZyme ID: MGYG000003574_02006
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
295	MGYG000003574_378|CGC1	33352.64	4.6117

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003574	3049750	MAG	Fiji	Oceania

• Gene Location: Start: 3221; End: 4108 Strand: +

Full Sequence      

MIIERFLTPEDDLQAAFDSMPKNAFVHLASGIYHQKVMIRTPGLTIIGQGAKNTILVFDD
YAQKLDEQGREYITFRTWTVAVCADGITMQDLSIVNNALQPEKKGQEVALSVYADDFTMS
RCTLTSTQDTLFLGPLPPDLIERYDGFLCDELRQNRLLRQRFADCRIEGTVDFIFGCGEA
LFENCEIRSLRDARDIGYIAAPAHALEQTEGFLFRNCRLTCEEGVSPGSVYLARPWRDYG
LTAFENCSMEGHIAPAGFDKWNDTHRDETARFFETPAVPGRVGWINRKPGHESEE

Enzyme Prediction     

No EC number prediction in MGYG000003574_02006.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	13	275	1.9e-67	0.8298611111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	1.87e-45	11	274	95	369	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
PLN02682	PLN02682	1.16e-41	13	284	85	343	pectinesterase family protein
pfam01095	Pectinesterase	5.38e-39	13	262	15	246	Pectinesterase.
PLN02773	PLN02773	1.23e-35	13	284	20	278	pectinesterase
PLN02497	PLN02497	5.36e-35	13	287	47	305	probable pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADU22686.1	4.53e-95	7	284	6	284
APO48005.1	2.79e-56	13	289	14	301
QPK93461.1	2.79e-56	13	289	14	301
QZN76920.1	1.08e-55	13	295	31	330
AIQ73518.1	1.42e-55	13	274	15	278

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3UW0_A	3.47e-25	8	274	38	327	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
2NSP_A	2.67e-20	28	274	39	303	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
1GQ8_A	1.37e-19	6	284	19	281	Pectinmethylesterase from Carrot [Daucus carota]
1XG2_A	1.12e-17	6	262	15	249	ChainA, Pectinesterase 1 [Solanum lycopersicum]
5C1C_A	7.41e-16	12	263	24	250	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8VYZ3	1.38e-26	13	294	99	367	Probable pectinesterase 53 OS=Arabidopsis thaliana OX=3702 GN=PME53 PE=2 SV=1
Q8LPF3	2.74e-26	13	273	74	315	Probable pectinesterase 68 OS=Arabidopsis thaliana OX=3702 GN=PME68 PE=2 SV=1
Q9FM79	9.27e-26	13	284	95	354	Pectinesterase QRT1 OS=Arabidopsis thaliana OX=3702 GN=QRT1 PE=1 SV=1
Q9LVQ0	4.94e-25	13	284	20	278	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q9ZQA3	8.76e-25	12	274	103	345	Probable pectinesterase 15 OS=Arabidopsis thaliana OX=3702 GN=PME15 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000083	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003574_02006.