CAZyme Information: MGYG000003574_02341

Basic Information

• Species: CAG-110 sp900770015
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; CAG-110; CAG-110 sp900770015
• CAZyme ID: MGYG000003574_02341
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
944		106302.54	5.209

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003574	3049750	MAG	Fiji	Oceania

• Gene Location: Start: 165; End: 2999 Strand: +

Full Sequence      

MNFVLGINHTVFYVEPEGVEGVRRIAGTVAKDIQAVTGQLPEVTDRLTEKGQVILCATLG
RSPMADRLLARGVLDGERLRGRREVYQIALTEIGGNPALVICGSDKRGTIYGMFALSEYI
GVSPLCFFGDAEPLQRDCVPIGRDIETVSKEPSVRYRGFFINDEWPCFGTWATTHYGDVN
ARCYDKIFEFLLRMKGNYLWPAMWASSFPLDGPGSANEELADLYGVVMGYSHHEPCLRAS
EEWDKVRGEGSRYGNEWNFYTNEQGLLNYWEDALIRSGGYENIITIGMRGERDTSMLGED
STLEENIALLKRIITKQRELIRRHGKKDAPQLLALYKEVERYFHGDESTEGLRSWKELDD
VLFLLCEDNHNHLRTVPPKDMRNHPGGWGMYYHFDYHGGPVSYEWVDSTPLSVTWEQMTQ
AWEYGIRDLWIVNVGDLKFHEVPLTYFLALAYDYDKWGSGNPHSAKEYTALWAKSTFPGV
PEQLQAEIGDVLRDYIHLNSLRRPEALNEGIYHPCHYGEADRMLAIAENLESRSAAVWEA
LPPKQRDAYYSMVHYPAMASANLVKMHLYAAKNAHYAAQGKPVANRYGKLTEECIARDLA
LAEEFGAFREGKWDGMQLASHIGFTRWNDDDCRYPVIRKVTPLRKAFMKVSRADREALAT
KIYGGPMVIEVPDFCDAGCDTVTLEIANGGSVPFSFRIEAERELPRWLTVEPDSGTVTEQ
TQVTLRCDRSRLPKECQTCTLPVTDGDAVVALRVSGRAVPTDALMPMTFLERNGVISILA
EHYSEKQDVPGAAFGRLEDYGKYGSGMKVFPSTAEFEEGELCPRLTYSFLIGEEGDYQVE
ILTAPNNPVQIGSPVKLLVETAGQKQVLELLPPDFRAGENSDPRWCRGVLNQIHSAKTGL
HFPAGVQTLTLGAMSPGVVIEKILIYRDAPLPSYLGPRESWFRR

Enzyme Prediction     

EC	3.2.1.131

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	10	923	1.3e-202	0.9813486370157819

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	1.88e-162	150	505	1	333	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	2.56e-42	768	939	1	172	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.
pfam03648	Glyco_hydro_67N	0.001	33	116	44	120	Glycosyl hydrolase family 67 N-terminus. Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the N-terminal region of alpha-glucuronidase. The N-terminal domain forms a two-layer sandwich, each layer being formed by a beta sheet of five strands. A further two helices form part of the interface with the central, catalytic, module (pfam07488).
pfam19190	BACON_2	0.001	674	730	10	65	Viral BACON domain. This family represents a distinct class of BACON domains found in crAss-like phages, the most common viral family in the human gut, in which they are found in tail fiber genes. This suggests they may play a role in phage-host interactions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QAY62444.1	0.0	14	926	13	918
QAY71183.1	1.13e-307	14	940	19	959
ACZ30646.1	1.12e-298	14	940	24	964
QJU15646.1	6.46e-288	14	943	16	972
ASU31298.1	1.83e-287	14	943	16	972

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6NPS_A	1.11e-255	11	942	21	965	Crystalstructure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112],6NPS_B Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112]
4ZMH_A	1.43e-157	14	940	27	933	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
7PUG_A	8.13e-118	10	630	26	638	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
4C90_A	8.39e-117	13	630	56	653	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
7PXQ_A	8.45e-116	10	630	25	637	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003574_02341.