CAZyme Information: MGYG000003575_00533

Basic Information

• Species: Treponema_D sp900770075
• Lineage: Bacteria; Spirochaetota; Spirochaetia; Treponematales; Treponemataceae; Treponema_D; Treponema_D sp900770075
• CAZyme ID: MGYG000003575_00533
• CAZy Family: CE12
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
525	MGYG000003575_72|CGC1	57217.8	7.8769

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003575	2346376	MAG	Fiji	Oceania

• Gene Location: Start: 8845; End: 10422 Strand: +

Full Sequence      

MKKLLAATLAVFAGMSLSVSALEKSIADNEKVEKVEAITSVASTKGKKIYVVGDSTFSAF
SDPYYYPRYGIGTKLQDYLNPSKVEVINLAMSGRSSKSFLTEANYKTLVKSIKKGDYLII
GFGHNDEKTEEARYTNPNGSKEESGSFKNSLYENYIKLAQSKKAIPVLCTPIVRRAPGKA
YEGSYVHITKDTPEFKGGDYPKAIRELGKETGVLVLDNTAYTKELYEKLGDDGTVKFHAW
LGHKPGSVDNTHLNTYGASVLAYHVVTQMASADKAFAKLLKADIAEPTEAILVQNPQYIV
PVYSEFTPADKSTVFQTTEPWYGTVFGDMGGLEKIADPALYEIVEENGKVVMHSGTTDGK
TAAGKIASGSDGLAFYFQQIPAGKDFTLSATATVRNATKNNQVSFGLMVRDDVHIDKYDN
QVKSDYVAAGCLKLAKGEGAWSSTFARLDGTLSENTVSKQEFPAAGTKIKLSIVKAGDSY
TVTFGKDSAVFNAKLTEVDSKWVYAGLYTVRSAYVEYSDIKLEIK

Enzyme Prediction     

No EC number prediction in MGYG000003575_00533.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE12	48	268	7.9e-55	0.9904761904761905

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01821	Rhamnogalacturan_acetylesterase_like	1.22e-51	48	262	2	191	Rhamnogalacturan_acetylesterase_like subgroup of SGNH-hydrolases. Rhamnogalacturan acetylesterase removes acetyl esters from rhamnogalacturonan substrates, and renders them susceptible to degradation by rhamnogalacturonases. Rhamnogalacturonans are highly branched regions in pectic polysaccharides, consisting of repeating -(1,2)-L-Rha-(1,4)-D-GalUA disaccharide units, with many rhamnose residues substituted by neutral oligosaccharides such as arabinans, galactans and arabinogalactans. Extracellular enzymes participating in the degradation of plant cell wall polymers, such as Rhamnogalacturonan acetylesterase, would typically be found in saprophytic and plant pathogenic fungi and bacteria.
cd01827	sialate_O-acetylesterase_like1	1.65e-08	48	265	2	183	sialate O-acetylesterase_like family of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
pfam00657	Lipase_GDSL	1.67e-08	49	265	1	224	GDSL-like Lipase/Acylhydrolase.
cd00229	SGNH_hydrolase	3.77e-07	49	265	1	184	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
pfam13472	Lipase_GDSL_2	2.24e-05	51	257	1	173	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSI01052.1	1.41e-175	1	525	1	527
ADL50681.1	5.81e-122	49	524	47	514
ACR72407.1	5.59e-113	49	521	4	472
QAV09174.1	3.65e-110	38	522	1403	1881
AEE17245.1	4.87e-93	23	289	5	269

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1DEO_A	1.86e-10	49	262	3	205	RHAMNOGALACTURONANACETYLESTERASE FROM ASPERGILLUS ACULEATUS AT 1.55 A RESOLUTION WITH SO4 IN THE ACTIVE SITE [Aspergillus aculeatus],1DEX_A RHAMNOGALACTURONAN ACETYLESTERASE FROM ASPERGILLUS ACULEATUS AT 1.9 A RESOLUTION [Aspergillus aculeatus],1K7C_A Rhamnogalacturonan acetylesterase with seven N-linked carbohydrate residues distributed at two N-glycosylation sites refined at 1.12 A resolution [Aspergillus aculeatus],1PP4_A The crystal structure of rhamnogalacturonan acetylesterase in space group P3121 [Aspergillus aculeatus],1PP4_B The crystal structure of rhamnogalacturonan acetylesterase in space group P3121 [Aspergillus aculeatus]
3C1U_A	4.58e-10	49	262	3	205	ChainA, Rhamnogalacturonan acetylesterase [Aspergillus aculeatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31523	7.10e-18	48	262	7	205	Rhamnogalacturonan acetylesterase RhgT OS=Bacillus subtilis (strain 168) OX=224308 GN=rhgT PE=1 SV=1
O31528	2.01e-14	49	262	5	195	Probable rhamnogalacturonan acetylesterase YesY OS=Bacillus subtilis (strain 168) OX=224308 GN=yesY PE=1 SV=1
Q5BAA2	3.67e-13	37	262	5	217	Rhamnogalacturonan acetylesterase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=AN2528 PE=1 SV=1
Q00017	1.27e-09	49	262	20	222	Rhamnogalacturonan acetylesterase OS=Aspergillus aculeatus OX=5053 GN=rha1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000413	0.998444	0.000572	0.000201	0.000188	0.000165

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003575_00533.