CAZyme Information: MGYG000003575_00537

Basic Information

• Species: Treponema_D sp900770075
• Lineage: Bacteria; Spirochaetota; Spirochaetia; Treponematales; Treponemataceae; Treponema_D; Treponema_D sp900770075
• CAZyme ID: MGYG000003575_00537
• CAZy Family: GT8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
291	MGYG000003575_72|CGC1	34212.48	7.8064

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003575	2346376	MAG	Fiji	Oceania

• Gene Location: Start: 13187; End: 14062 Strand: -

Full Sequence      

MKNILFCGNCKVFDGMLSAMLSIFKRTDSKEPFTFFIFTMDVSHLKPDYTPLTDGQAAFL
EELAKSYNSENRVVKIDVTDAYMREFSGCPNEGCYCSPYTLIRLFADLYEEIPEKLLYLD
VDILFNRDMDLLWNTDVEGFEYAAARDHYGKFLIHPNFVNAGVLLFNMKECKKTGLFEKC
RELIKTKKLVFADEGAIIRCTTKKKMLSQRFNDQKFLYKNTVIRHFSKRLFWTPYPHTAN
IKQWNVTKIHKIFGYENFDDILYEYIYQKNRFEREICSVSSVSSAETQKLN

Enzyme Prediction     

No EC number prediction in MGYG000003575_00537.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	2	227	3.5e-30	0.8443579766536965

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04194	GT8_A4GalT_like	1.02e-33	2	226	1	239	A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The members of this family of glycosyltransferases catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The enzymes exhibit broad substrate specificities. The known functions found in this family include: Alpha-1,4-galactosyltransferase, LOS-alpha-1,3-D-galactosyltransferase, UDP-glucose:(galactosyl) LPS alpha1,2-glucosyltransferase, UDP-galactose: (glucosyl) LPS alpha1,2-galactosyltransferase, and UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase. Alpha-1,4-galactosyltransferase from N. meningitidis adds an alpha-galactose from UDP-Gal (the donor) to a terminal lactose (the acceptor) of the LOS structure of outer membrane. LOSs are virulence factors that enable the organism to evade the immune system of host cells. In E. coli, the three alpha-1,2-glycosyltransferases, that are involved in the synthesis of the outer core region of the LPS, are all members of this family. The three enzymes share 40 % of sequence identity, but have different sugar donor or acceptor specificities, representing the structural diversity of LPS.
pfam01501	Glyco_transf_8	6.22e-15	33	187	30	186	Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase.
COG1442	RfaJ	4.27e-14	2	212	3	211	Lipopolysaccharide biosynthesis protein, LPS:glycosyltransferase [Cell wall/membrane/envelope biogenesis].
cd00505	Glyco_transf_8	1.06e-12	15	170	15	164	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.
cd02537	GT8_Glycogenin	2.77e-04	99	250	79	186	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNL97925.1	3.16e-150	1	275	1	275
QQA01162.1	2.66e-136	1	276	1	276
AEE15925.1	1.43e-74	1	266	1	264
QAT42778.1	4.74e-64	3	265	2	266
ANK66321.1	6.71e-63	3	265	2	266

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P43974	2.35e-09	3	212	40	245	Putative glycosyltransferase HI_0258 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_0258 PE=3 SV=2
A0A0H2URH7	9.70e-07	93	179	370	458	Glycosyltransferase GlyA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyA PE=3 SV=1
Q3UHH8	1.80e-06	98	254	159	313	Glucoside xylosyltransferase 1 OS=Mus musculus OX=10090 GN=Gxylt1 PE=1 SV=2
Q6GX83	3.36e-06	98	254	190	344	Glucoside xylosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Gxylt1 PE=2 SV=2
Q4G148	4.51e-06	98	254	195	349	Glucoside xylosyltransferase 1 OS=Homo sapiens OX=9606 GN=GXYLT1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003575_00537.