CAZyme Information: MGYG000003575_00558

Basic Information

• Species: Treponema_D sp900770075
• Lineage: Bacteria; Spirochaetota; Spirochaetia; Treponematales; Treponemataceae; Treponema_D; Treponema_D sp900770075
• CAZyme ID: MGYG000003575_00558
• CAZy Family: PL9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
302		32338.75	8.1855

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003575	2346376	MAG	Fiji	Oceania

• Gene Location: Start: 3751; End: 4659 Strand: -

Full Sequence      

MKVTKFLLGAALVSAAAMFVSCSDLSSAEESESSSSRAAATTYYVSTADQLYTAANKVNG
GDTIVLNSNITLTKQLQLLRSGSSGSVITLNGNGKTLDCSKFTGWGVKVNGSYWTIKNLT
VKNASDCGLVFQIGGNNRAEYCKFLNNGDSGLQVYNSAHDVTVTKCESYYNYDKATGGEN
ADGFAAKLSGGKNIKFNYCIAKYNSDDGWDLYSQPYQVTMNHCEASYNGYINSSYQTTSD
GDGNGFKLGSKYANVSHRVLYCTAKGNLKYGIDANGNTAKQTITGCTVTNNKEGQISSRT
SY

Enzyme Prediction     

No EC number prediction in MGYG000003575_00558.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL9	35	299	2.6e-68	0.7112299465240641

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13229	Beta_helix	1.17e-07	110	287	7	157	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
cd14251	PL-6	0.006	45	147	1	104	Polysaccharide Lyase Family 6. Polysaccharide Lyase Family 6 is a family of beta-helical polysaccharide lyases. Members include alginate lyase (EC 4.2.2.3) and chondroitinase B (EC 4.2.2.19). Chondroitinase B is an enzyme that only cleaves the beta-(1,4)-linkage of dermatan sulfate (DS), leading to 4,5-unsaturated dermatan sulfate disaccharides as the product. DS is a highly sulfated, unbranched polysaccharide belonging to a family of glycosaminoglycans (GAGs) composed of alternating hexosamine (gluco- or galactosamine) and uronic acid (D-glucuronic or L-iduronic acid) moieties. DS contains alternating 1,4-beta-D-galactosamine (GalNac) and 1,3-alpha-L-iduronic acid units. The related chondroitin sulfate (CS) contains alternating GalNac and 1,3-beta-D-glucuronic acid units. Alginate lyases (known as either mannuronate (EC 4.2.2.3) or guluronate lyases (EC 4.2.2.11) catalyze the degradation of alginate, a copolymer of alpha-L-guluronate and its C5 epimer beta-D-mannuronate.
pfam14592	Chondroitinas_B	0.007	45	147	1	105	Chondroitinase B. This family includes chondroitinases. These enzymes cleave the glycosaminoglycan dermatan sulfate.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEV96476.1	4.01e-76	45	294	41	283
BAV04029.1	4.28e-75	45	291	39	278
ADY53896.1	4.70e-75	43	278	38	268
QXU42793.1	5.84e-73	45	294	52	294
QDW24104.1	8.26e-73	45	294	52	294

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1RU4_A	3.67e-27	105	283	108	284	ChainA, Pectate lyase [Dickeya chrysanthemi]
5OLQ_A	4.17e-08	106	249	119	266	Rhamnogalacturonanlyase [Bacteroides thetaiotaomicron],5OLQ_B Rhamnogalacturonan lyase [Bacteroides thetaiotaomicron],5OLQ_C Rhamnogalacturonan lyase [Bacteroides thetaiotaomicron],5OLR_A Rhamnogalacturonan lyase [Bacteroides thetaiotaomicron],5OLR_B Rhamnogalacturonan lyase [Bacteroides thetaiotaomicron],5OLR_C Rhamnogalacturonan lyase [Bacteroides thetaiotaomicron],5OLS_A Rhamnogalacturonan lyase [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0C1A6	7.44e-27	45	283	36	309	Pectate lyase L OS=Dickeya chrysanthemi OX=556 GN=pelL PE=3 SV=1
P0C1A7	2.68e-26	105	283	133	309	Pectate lyase L OS=Dickeya dadantii (strain 3937) OX=198628 GN=pelL PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000003	1.000009	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003575_00558.