CAZyme Information: MGYG000003577_01363

Basic Information

• Species: Anaeroplasma sp900770055
• Lineage: Bacteria; Firmicutes; Bacilli; Acholeplasmatales; Anaeroplasmataceae; Anaeroplasma; Anaeroplasma sp900770055
• CAZyme ID: MGYG000003577_01363
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
448	MGYG000003577_188|CGC1	51721.36	4.9306

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003577	1902494	MAG	Fiji	Oceania

• Gene Location: Start: 8273; End: 9619 Strand: -

Full Sequence      

MKKLQILALLLIISLLFVSCSNNNLTSNTTTSPTSIISTDINENRDDIYQSLEDYFNTLL
ENTESYIPYWNKEGFKGKWNYIDGVFLNSLINLYHITNETKYSNFIINYVNYYIDSNGYF
LNLKDSSAIGFTEGELDTICASRILFDLYNLTNDIRYQKAIGYTYDKLLEIPKASGTNNF
SHKVSYLNQIWLDGMYMYVPFYARYAITYNKPEILDEIISQYKTIRNNMFNSETGLYYHG
YDTTKTIFWAQTNGCSKNHWLRSMGWYIVSLCDAIEYFEAGANRDYLISLLSEAINGILR
YQDKSTGMFYQIIDKMKYSVNVPYEYFKSLKNDKYTQDTIVENYLESSGSSMVAYSILKA
ARLGYINNSYLPIGKQIFEGIYDHSFKNGCLNDICITAGLGPENKTYRDGSVEYYLAEPV
GVDDAKGVGPFIMAYLEYRYGNNMNNSK

Enzyme Prediction     

No EC number prediction in MGYG000003577_01363.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	72	438	2.6e-89	0.9759036144578314

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	1.23e-75	53	438	13	353	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	2.72e-64	78	438	26	339	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWI66987.1	3.81e-114	151	440	1	290
CCV66002.1	5.60e-101	52	437	4	371
CCV64366.1	5.52e-98	50	437	4	372
CCV64024.1	7.46e-96	48	438	3	373
AVQ19788.1	9.75e-91	59	440	4	367

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	2.82e-61	79	438	23	358	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	7.59e-56	78	437	38	363	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	3.18e-55	78	437	28	353	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3QWT_A	8.28e-14	189	408	165	355	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	6.33e-13	189	408	166	356	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	4.15e-55	78	437	38	363	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	8.69e-28	197	437	1	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	8.69e-28	197	437	1	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000001	1.000063	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003577_01363.