CAZyme Information: MGYG000003578_02391

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UMGS2037
• CAZyme ID: MGYG000003578_02391
• CAZy Family: GT35
• CAZyme Description: Glycogen phosphorylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
636		73873.89	5.5708

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003578	3478423	MAG	Fiji	Oceania

• Gene Location: Start: 4; End: 1914 Strand: +

Full Sequence      

MLFRSYHFGLFKQVFEDNLQKAEKNEWIEKNSWLTRTSVSFPIQFGDCKVVSRMYDIDVI
GYENGVNKLHLFDVETVDESIVEDGITFDKEAVEKNLTLFLYPDDSDEAGNLLRIYQQYF
MVSNAAHLILKEMKEKKYDLHKLYNHAVIQINDTHPTMVIPELIRILVEEKAFPLDEAIE
VVSRTCAYTNHTILAEALEKWPLAYLEKVVPQLVPYIKELDKRIAAKYEDPKVQIIDEDE
RVHMAHIDIHYGFSVNGVAAIHTDILKNTELNHFYKIYPEKFNNKTNGITFRRWLLSCNR
ELADFLTQTIGSEYKKNAQKLEKLLQFADDQKVLDAIEAIKRKKKEQLVSYVAKKEGVEL
NPDSIFDIQVKRLHEYKRQQMNALYIIHKYLEIKKGKKPSTPITFLFGAKAAPAYVIAQD
IIHLILCLQEIVNNDPDVSPYMTILMVENYNVSYAEKLIPACDISEQISLASKEASGTGN
MKFMLNGAVTLGTADGANVEIAELVGKENIYEFGVSSEEVIEHYAKADYVSKEYYKKSPV
TREAVDFIVSKQLLKVGHKENLQRLYKELLNKDWFMTLLDLEEYIKVKDQMFEDYSDREK
WKRMMLVNIAKAGFFSSDRTIEQYNEDIWKLEPIEK

Enzyme Prediction     

EC	2.4.1.1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT35	6	631	2.5e-203	0.9228486646884273

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0058	GlgP	0.0	6	633	142	750	Glucan phosphorylase [Carbohydrate transport and metabolism].
TIGR02093	P_ylase	0.0	6	631	131	794	glycogen/starch/alpha-glucan phosphorylases. This family consists of phosphorylases. Members use phosphate to break alpha 1,4 linkages between pairs of glucose residues at the end of long glucose polymers, releasing alpha-D-glucose 1-phosphate. The nomenclature convention is to preface the name according to the natural substrate, as in glycogen phosphorylase, starch phosphorylase, maltodextrin phosphorylase, etc. Name differences among these substrates reflect differences in patterns of branching with alpha 1,6 linkages. Members include allosterically regulated and unregulated forms. A related family, TIGR02094, contains examples known to act well on particularly small alpha 1,4 glucans, as may be found after import from exogenous sources. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
cd04300	GT35_Glycogen_Phosphorylase	0.0	6	631	134	795	glycogen phosphorylase and similar proteins. This is a family of oligosaccharide phosphorylases. It includes yeast and mammalian glycogen phosphorylases, plant starch/glucan phosphorylase, as well as the maltodextrin phosphorylases of bacteria. The members of this family catalyze the breakdown of oligosaccharides into glucose-1-phosphate units. They are important allosteric enzymes in carbohydrate metabolism. The allosteric control mechanisms of yeast and mammalian members of this family are different from that of bacterial members. The members of this family belong to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
pfam00343	Phosphorylase	0.0	6	631	50	661	Carbohydrate phosphorylase. The members of this family catalyze the formation of glucose 1-phosphate from one of the following polyglucoses; glycogen, starch, glucan or maltodextrin.
PRK14985	PRK14985	5.70e-179	5	630	139	795	maltodextrin phosphorylase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM02364.1	0.0	5	632	129	756
AOZ95691.1	0.0	5	631	142	768
ADL34851.1	0.0	5	631	142	768
ALS15614.1	0.0	5	631	128	752
QGH25122.1	0.0	5	631	128	752

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4L22_A	7.54e-283	5	629	130	755	Crystalstructure of putative glycogen phosphorylase from Streptococcus mutans [Streptococcus mutans UA159]
2C4M_A	1.78e-149	6	633	141	790	Starchphosphorylase: structural studies explain oxyanion-dependent kinetic stability and regulatory control. [Corynebacterium callunae],2C4M_B Starch phosphorylase: structural studies explain oxyanion-dependent kinetic stability and regulatory control. [Corynebacterium callunae],2C4M_C Starch phosphorylase: structural studies explain oxyanion-dependent kinetic stability and regulatory control. [Corynebacterium callunae],2C4M_D Starch phosphorylase: structural studies explain oxyanion-dependent kinetic stability and regulatory control. [Corynebacterium callunae]
5OX0_A	4.60e-149	6	633	162	830	GlycogenPhosphorylase in complex with CK898 [Oryctolagus cuniculus]
2GJ4_A	7.66e-149	6	633	150	818	Structureof rabbit muscle glycogen phosphorylase in complex with ligand [Oryctolagus cuniculus]
2FFR_A	7.87e-149	6	633	150	818	Crystallographicstudies on N-azido-beta-D-glucopyranosylamine, an inhibitor of glycogen phosphorylase: comparison with N-acetyl-beta-D-glucopyranosylamine [Oryctolagus cuniculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P29849	4.06e-288	5	631	126	751	Maltodextrin phosphorylase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=malP PE=3 SV=2
P39123	5.93e-151	6	634	142	797	Glycogen phosphorylase OS=Bacillus subtilis (strain 168) OX=224308 GN=glgP PE=2 SV=1
P79334	5.63e-150	6	633	162	830	Glycogen phosphorylase, muscle form OS=Bos taurus OX=9913 GN=PYGM PE=1 SV=3
O18751	1.12e-149	6	633	162	830	Glycogen phosphorylase, muscle form OS=Ovis aries OX=9940 GN=PYGM PE=2 SV=3
Q9WUB3	3.45e-148	6	633	162	830	Glycogen phosphorylase, muscle form OS=Mus musculus OX=10090 GN=Pygm PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003578_02391.