CAZyme Information: MGYG000003581_00057

Basic Information

• Species: HGM12814 sp900770165
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; HGM12814; HGM12814 sp900770165
• CAZyme ID: MGYG000003581_00057
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
151		16497.41	4.4432

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003581	2356172	MAG	Fiji	Oceania

• Gene Location: Start: 26328; End: 26783 Strand: -

Full Sequence      

MPCDVWQYTSSGKVDGISGNVDMNIMYRDLINEIGECGNYGPTTSSSPENDITYYTVQSG
DTLSGIASSYGTTYRYLAEINGIENPNLIYPGQTLIIPKGQSRTYTVKSGDTLWDIASKC
LGRGSRYPEIKTLNGLTSDTIYPGQVLKIPN

Enzyme Prediction     

No EC number prediction in MGYG000003581_00057.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM50	55	98	3e-16	0.975
CBM50	105	150	6e-16	0.975

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00118	LysM	1.89e-16	53	97	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
PRK11198	PRK11198	3.53e-16	98	150	91	146	LysM domain/BON superfamily protein; Provisional
pfam01476	LysM	4.93e-15	55	98	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
pfam01476	LysM	2.14e-14	105	150	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
smart00257	LysM	7.58e-14	54	97	1	44	Lysin motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDM70433.1	3.45e-29	6	151	175	321
QEK16471.1	6.90e-27	5	149	172	325
QYX27151.1	2.64e-26	5	149	172	325
QQR02580.1	1.09e-25	39	150	455	563
QHZ46391.1	5.13e-23	4	149	162	316

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2MKX_A	3.76e-08	53	100	5	51	Solutionstructure of LysM the peptidoglycan binding domain of autolysin AtlA from Enterococcus faecalis [Enterococcus faecalis V583]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8CMN2	7.77e-16	10	150	47	191	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) OX=176280 GN=sle1 PE=3 SV=1
Q5HRU2	7.77e-16	10	150	47	191	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=sle1 PE=3 SV=1
Q49UX4	1.97e-14	41	149	72	193	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41) OX=342451 GN=sle1 PE=3 SV=1
Q7A7E0	9.31e-13	20	149	56	201	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus aureus (strain N315) OX=158879 GN=sle1 PE=1 SV=1
P0C1U7	9.31e-13	20	149	56	201	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus aureus OX=1280 GN=sle1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000008	0.000028	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003581_00057.