CAZyme Information: MGYG000003583_01432

Basic Information

• Species: Ruminococcus_C sp900770195
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruminococcus_C; Ruminococcus_C sp900770195
• CAZyme ID: MGYG000003583_01432
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
315	MGYG000003583_79|CGC1	36678.27	4.6583

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003583	2191682	MAG	Fiji	Oceania

• Gene Location: Start: 9553; End: 10500 Strand: -

Full Sequence      

MQKTVNPFATEKAKKLLNYLSETAGKSIITGQHTQTNPMEEIDYIRSKTGKEPLLRGFEM
LAYSPNINYQDASEECLTEVYENRNTMETALCWAKESQGIVTLSFHWFSPIGGHDKSFYA
KNTDFDASKILIDGTPERTAFYHDMDVIAAELKKFQDADIPVLWRSFHESDGDWFWWGAK
GPKVAKELYQLMFDYYTKEYHLDNLLWVWNCRLAEGYPGDEYVDVISVDIYLEKYMKTDY
QEDYKKLIEATTRNKVAALAEVGYIPDIEMLEQSHTPWAYYMTWSKEFCIGEQYNTAEQL
KAMYSSSYAITNIHN

Enzyme Prediction     

No EC number prediction in MGYG000003583_01432.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	5	311	1.5e-98	0.9867986798679867

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	2.02e-48	5	311	1	308	Glycosyl hydrolase family 26.
COG4124	ManB2	6.42e-14	148	264	170	297	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK82137.1	1.12e-167	1	311	1	311
QNM01251.1	1.37e-159	4	311	8	333
AEB13973.1	9.10e-150	1	311	1	309
AOZ93051.1	1.01e-123	6	311	11	316
AZK45707.1	4.26e-122	6	311	8	313

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZM8_A	7.31e-62	6	311	147	443	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
6HPF_A	7.61e-61	5	311	7	306	Structureof Inactive E165Q mutant of fungal non-CBM carrying GH26 endo-b-mannanase from Yunnania penicillata in complex with alpha-62-61-di-galactosyl-mannotriose [Yunnania penicillata]
3WDQ_A	2.39e-49	5	311	35	348	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]
6Q75_A	1.49e-38	5	311	24	323	Thestructure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75],6Q75_B The structure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75]
6D2X_A	9.72e-35	9	287	9	311	Crystalstructure of the GH26 domain from PbGH26-GH5A endo-beta-mannanase/endo-beta-glucanase from Prevotella bryantii [Prevotella bryantii B14]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G2Q4H7	2.56e-60	6	311	176	472	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
Q5AWB7	3.29e-57	3	311	27	346	Probable mannan endo-1,4-beta-mannosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manE PE=3 SV=1
P49425	3.18e-52	9	288	151	433	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
A2R6F5	2.00e-45	5	307	29	325	Mannan endo-1,4-beta-mannosidase man26A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=man26A PE=1 SV=1
P55298	5.63e-45	5	305	157	449	Mannan endo-1,4-beta-mannosidase C OS=Piromyces sp. OX=45796 GN=MANC PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003583_01432.