CAZyme Information: MGYG000003583_01658

Basic Information

• Species: Ruminococcus_C sp900770195
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruminococcus_C; Ruminococcus_C sp900770195
• CAZyme ID: MGYG000003583_01658
• CAZy Family: GH124
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
388	MGYG000003583_88|CGC1	43112.14	5.0575

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003583	2191682	MAG	Fiji	Oceania

• Gene Location: Start: 11555; End: 12721 Strand: -

Full Sequence      

MTKRITSIAVVIMILISTLFCYNFTSITASASMAHSSSRDVQSSGVGNPFNYGERNTPEN
ASVSQMRAINHKMSVQEVKYAIYKEVDENWDLLKVRLGVTDREKVYALFLGLATRESTIG
HNGDGGDLETNAGGSFGTNAAQAYGPFQTAVTAYKNNNPNFMTEYDVPEMKQYDLTQQNF
YDCIISLHMGIRKVLHFVTLAINDQHMSGYTVIRNALKGFNTGWATPGDTAYYKDYPDEI
IALAHWYYSNGHLYDNEATWTTDPRASEYRSNPWSWWSDANPSLASVSSTPQVIEEATVN
PNADISQIKLGDANMDGEVNSKDATIILQDYARSIVGRKTILTMSVSDVNKDNAVNSKDA
VFVLQYYALLIVNSNYGGMEKFMGFSAN

Enzyme Prediction     

No EC number prediction in MGYG000003583_01658.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH124	31	260	3.3e-83	0.6325301204819277

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14255	Dockerin_III	2.32e-11	311	368	1	61	Type III dockerin repeat domain. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. Two specific calcium-dependent interactions between cohesin and dockerin appear to be essential for cellulosome assembly, type I and type II. This subfamily represents the atypical type III dockerins and related domains.
cd14256	Dockerin_I	1.13e-09	310	366	1	55	Type I dockerin repeat domain. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. The cellulosome consists of scaffoldin, a noncatalytic scaffolding polypeptide, that comprises repeating cohesion modules and a single carbohydrate-binding module (CBM). Specific calcium-dependent interactions between cohesins and dockerins appear to be essential for cellulosome assembly. This subfamily represents type I dockerins, which are responsible for anchoring a variety of enzymatic domains to the complex.
cd14253	Dockerin	4.70e-08	311	368	1	56	Dockerin repeat domain. Dockerins are modules in the cellulosome complex that often anchor catalytic subunits by binding to cohesin domains of scaffolding proteins. Three types of dockerins and their corresponding cohesin have been described in the literature. This alignment models two consecutive dockerin repeats, the functional unit.
pfam00404	Dockerin_1	1.92e-05	311	366	1	54	Dockerin type I repeat. The dockerin repeat is the binding partner of the cohesin domain pfam00963. The cohesin-dockerin interaction is the crucial interaction for complex formation in the cellulosome. The dockerin repeats, each bearing homology to the EF-hand calcium-binding loop bind calcium.
cd14255	Dockerin_III	0.009	304	336	33	65	Type III dockerin repeat domain. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. Two specific calcium-dependent interactions between cohesin and dockerin appear to be essential for cellulosome assembly, type I and type II. This subfamily represents the atypical type III dockerins and related domains.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADU21303.1	7.60e-104	35	329	49	336
SDS74621.1	6.08e-56	54	277	224	431
ABN51673.1	1.32e-54	58	274	145	346
ALX08796.1	5.77e-54	58	274	204	405
ANV76547.1	5.77e-54	58	274	204	405

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6G1G_A	2.79e-56	58	274	18	219	ChainA, Glycosyl Hydrolase [Acetivibrio thermocellus ATCC 27405],6G1I_A Chain A, Glycosyl Hydrolase [Acetivibrio thermocellus ATCC 27405],6G1I_B Chain B, Glycosyl Hydrolase [Acetivibrio thermocellus ATCC 27405]
2XQO_A	8.70e-54	58	274	38	239	ChainA, Cellulosome Enzyme, Dockerin Type I [Acetivibrio thermocellus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.007503	0.719064	0.272283	0.000497	0.000333	0.000289

TMHMM  Annotations     

start	end
7	29