CAZyme Information: MGYG000003584_00192

Basic Information

• Species: HGM11412 sp900770185
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; HGM11412; HGM11412 sp900770185
• CAZyme ID: MGYG000003584_00192
• CAZy Family: GH31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
838	MGYG000003584_6|CGC1	95490.03	4.9453

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003584	1810421	MAG	Fiji	Oceania

• Gene Location: Start: 4643; End: 7159 Strand: -

Full Sequence      

MKQYIFGQIRVQAICDRIIRIERKNGDSFFDENTFFVPDRNSLFKDGDFSKAVDGGVKIG
NYEIRPTDKKDACRVEVYKNGTLIYTVKECLNSGELPPLYCTPDVFAVADNPRVTVPAGG
YSVNRKGEYKIEENVLDVYLILCDGDFKLLREYYVRLTGRCEMPRLSTLGAWNSKYYPYT
DKEALQVIKDYRDHDYPLDNLVIDTDWRTDENGWGYDINEKLFPDMRAFLEKAHSEKVDI
MFNDHPEPVDGATVFEAKEIAYRERNLQSLLGIGLDTWWYDRNWLTALVSPTKNIPCETF
GMYLFYDITKHFYQKKSGNELIYRRPDIMANVDNIANGTYVKINSSASHRYPIQWTGDIL
SDESDLAQEVHNLIKGGNNCVAYVNADCGGHGGNPDKEMFIRWMQFGTLSPVFRPHCMNG
GLVRTREAWQYDNETVDIVRKFNNLRYRLLPVIYAQAHNAYVLGEPLFKAVGWNYPKDEK
ALKTEDEYMLGKDLLIAPIAGYPPKSLDEKDFVTPVEATYFNGTELKGEPIFVTRYKTLN
MNLNNVAPEEEVPCYNYSARFITSVRFDKAVELILRVDDGAKVWIDGELVLTDNMFHSAL
NHKLAVLEPNRTYSVKIEYFQGGAQAVAMLCYTEVVPQQNPSAYLPYGKWLDAFNGKICD
GNSTVSRAYGLCESPLFIRMGAVIPLAYEARNTKEQTWDKLVYDFYPVKGGTSEGVLYED
DTETTAYKAGEYRVSAYRAEYNAADNAFTLTLEPSAGEFNGEKAFQSRRILIKTHLTDQI
NSVKLVTVNGVEVPFKLNPKNAETFPLSATNDAPDGDVVTAEISVDLTKRYEIKIFVI

Enzyme Prediction     

No EC number prediction in MGYG000003584_00192.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	263	500	1.9e-50	0.5199063231850117

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01055	Glyco_hydro_31	4.67e-64	154	499	15	391	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
COG1501	YicI	1.97e-54	110	732	208	717	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
cd06595	GH31_u1	4.79e-54	158	453	1	304	glycosyl hydrolase family 31 (GH31); uncharacterized subgroup. This family represents an uncharacterized GH31 enzyme subgroup found in bacteria and eukaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
cd06589	GH31	1.24e-36	159	442	1	264	glycosyl hydrolase family 31 (GH31). GH31 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. In most cases, the pyranose moiety recognized in subsite -1 of the substrate binding site is an alpha-D-glucose, though some GH31 family members show a preference for alpha-D-xylose. Several GH31 enzymes can accommodate both glucose and xylose and different levels of discrimination between the two have been observed. Most characterized GH31 enzymes are alpha-glucosidases. In mammals, GH31 members with alpha-glucosidase activity are implicated in at least three distinct biological processes. The lysosomal acid alpha-glucosidase (GAA) is essential for glycogen degradation and a deficiency or malfunction of this enzyme causes glycogen storage disease II, also known as Pompe disease. In the endoplasmic reticulum, alpha-glucosidase II catalyzes the second step in the N-linked oligosaccharide processing pathway that constitutes part of the quality control system for glycoprotein folding and maturation. The intestinal enzymes sucrase-isomaltase (SI) and maltase-glucoamylase (MGAM) play key roles in the final stage of carbohydrate digestion, making alpha-glucosidase inhibitors useful in the treatment of type 2 diabetes. GH31 alpha-glycosidases are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
cd06603	GH31_GANC_GANAB_alpha	5.98e-32	348	499	225	374	neutral alpha-glucosidase C, neutral alpha-glucosidase AB. This subgroup includes the closely related glycosyl hydrolase family 31 (GH31) isozymes, neutral alpha-glucosidase C (GANC) and the alpha subunit of heterodimeric neutral alpha-glucosidase AB (GANAB). Initially distinguished on the basis of differences in electrophoretic mobility in starch gel, GANC and GANAB have been shown to have other differences, including those of substrate specificity. GANC and GANAB are key enzymes in glycogen metabolism that hydrolyze terminal, non-reducing 1,4-linked alpha-D-glucose residues from glycogen in the endoplasmic reticulum. The GANC/GANAB family includes the alpha-glucosidase II (ModA) from Dictyostelium discoideum as well as the alpha-glucosidase II (GLS2, or ROT2 - Reversal of TOR2 lethality protein 2) from Saccharomyces cerevisiae.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIE84875.1	1.52e-123	7	785	18	784
ARN57252.1	1.63e-114	88	818	256	841
AQQ09813.1	1.95e-109	88	818	256	841
BAX78840.1	8.19e-49	5	801	26	726
QUT89092.1	1.27e-44	4	807	30	735

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7WJ9_A	5.40e-39	106	499	159	555	ChainA, Alpha-xylosidase [Lactococcus lactis subsp. cremoris MG1363],7WJ9_B Chain B, Alpha-xylosidase [Lactococcus lactis subsp. cremoris MG1363],7WJ9_C Chain C, Alpha-xylosidase [Lactococcus lactis subsp. cremoris MG1363],7WJ9_D Chain D, Alpha-xylosidase [Lactococcus lactis subsp. cremoris MG1363],7WJ9_E Chain E, Alpha-xylosidase [Lactococcus lactis subsp. cremoris MG1363],7WJ9_F Chain F, Alpha-xylosidase [Lactococcus lactis subsp. cremoris MG1363],7WJA_A Chain A, Alpha-xylosidase [Lactococcus lactis subsp. cremoris MG1363],7WJB_A Chain A, Alpha-xylosidase [Lactococcus lactis subsp. cremoris MG1363],7WLG_A Chain A, Alpha-xylosidase [Lactococcus lactis subsp. cremoris MG1363],7WLG_B Chain B, Alpha-xylosidase [Lactococcus lactis subsp. cremoris MG1363],7WLG_C Chain C, Alpha-xylosidase [Lactococcus lactis subsp. cremoris MG1363],7WLG_D Chain D, Alpha-xylosidase [Lactococcus lactis subsp. cremoris MG1363],7WLG_E Chain E, Alpha-xylosidase [Lactococcus lactis subsp. cremoris MG1363],7WLG_F Chain F, Alpha-xylosidase [Lactococcus lactis subsp. cremoris MG1363]
7WJC_A	5.36e-38	106	499	159	555	ChainA, Alpha-xylosidase [Lactococcus lactis subsp. cremoris MG1363],7WJD_A Chain A, Alpha-xylosidase [Lactococcus lactis subsp. cremoris MG1363],7WJE_A Chain A, Alpha-xylosidase [Lactococcus lactis subsp. cremoris MG1363],7WJF_A Chain A, Alpha-xylosidase [Lactococcus lactis subsp. cremoris MG1363]
5F7C_A	4.09e-26	125	582	269	743	Crystalstructure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5F7C_B Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5F7C_C Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5F7C_D Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
3NUK_A	5.10e-25	120	499	117	560	ChainA, ALPHA-GLUCOSIDASE [Blautia obeum ATCC 29174],3NUK_B Chain B, ALPHA-GLUCOSIDASE [Blautia obeum ATCC 29174],3PHA_A The crystal structure of the W169Y mutant of alpha-glucosidase (gh31 family) from Ruminococcus obeum atcc 29174 in complex with acarbose [Blautia obeum ATCC 29174],3PHA_B The crystal structure of the W169Y mutant of alpha-glucosidase (gh31 family) from Ruminococcus obeum atcc 29174 in complex with acarbose [Blautia obeum ATCC 29174],3PHA_C The crystal structure of the W169Y mutant of alpha-glucosidase (gh31 family) from Ruminococcus obeum atcc 29174 in complex with acarbose [Blautia obeum ATCC 29174],3PHA_D The crystal structure of the W169Y mutant of alpha-glucosidase (gh31 family) from Ruminococcus obeum atcc 29174 in complex with acarbose [Blautia obeum ATCC 29174],6C9Z_A Chain A, Glycosyl hydrolase, family 31 [Blautia obeum ATCC 29174],6C9Z_B Chain B, Glycosyl hydrolase, family 31 [Blautia obeum ATCC 29174],6CA3_A Chain A, Glycosyl hydrolase, family 31 [Blautia obeum ATCC 29174],6CA3_B Chain B, Glycosyl hydrolase, family 31 [Blautia obeum ATCC 29174]
3M46_A	2.07e-24	120	499	117	560	ChainA, Uncharacterized protein [Blautia obeum ATCC 29174],3M46_B Chain B, Uncharacterized protein [Blautia obeum ATCC 29174]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9P999	5.47e-27	136	528	190	599	Alpha-xylosidase OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=xylS PE=1 SV=1
Q8BVW0	3.10e-26	24	508	225	719	Neutral alpha-glucosidase C OS=Mus musculus OX=10090 GN=Ganc PE=1 SV=2
Q9F234	1.66e-24	129	741	223	730	Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens OX=1425 PE=3 SV=1
Q9BE70	2.11e-24	132	508	182	590	Neutral alpha-glucosidase C (Fragment) OS=Macaca fascicularis OX=9541 GN=GANC PE=2 SV=2
Q8TET4	4.61e-24	132	508	327	735	Neutral alpha-glucosidase C OS=Homo sapiens OX=9606 GN=GANC PE=2 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003584_00192.