CAZyme Information: MGYG000003584_01159

Basic Information

• Species: HGM11412 sp900770185
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; HGM11412; HGM11412 sp900770185
• CAZyme ID: MGYG000003584_01159
• CAZy Family: GH1
• CAZyme Description: Beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
432	MGYG000003584_33|CGC1	50690.3	6.1217

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003584	1810421	MAG	Fiji	Oceania

• Gene Location: Start: 3846; End: 5144 Strand: -

Full Sequence      

MNDVFSIKGFNFPENFLWGSATAGHQIEGDNVNADKYFDELETAETTKDKNFAPSGKACN
HYELYKDDIKLLKSLGHQAFRLSVEWSRIEPREGVFDEAATNHYIDEVKTLHDSGIKVFL
TLVHFSKPKWFTDKGGFGDLDNVKYFERYIDYIVPKVKDYVSFYNVFNEENLGFDEKSLK
TKFNSVFFHAKGYHTIKKYTDAPVSSAHAFVLQFPKRLHDKFDNAVADMRDVYLNEYFFH
AIRTGEVLVPGYGHKIDKSVKDTCDFWSINIYVRSMVDARKIDFNGERYPFSKANMIDMP
FYLDEFDPENVVHNLTRLMDKPVYISENGCACDDDDLRLVFMTEYLSAFKLCIDMGVDIR
GYLHWSFMDNYEWYSFVPRFGLVGVDFKTFKRTPKNSAYFYKEIIENNGYNHEMLKKYLK
KYPSLPYNKEDF

Enzyme Prediction     

No EC number prediction in MGYG000003584_01159.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	11	409	1.1e-92	0.9883449883449883

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2723	BglB	1.93e-79	11	409	3	454	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
pfam00232	Glyco_hydro_1	1.88e-69	12	410	5	453	Glycosyl hydrolase family 1.
PLN02998	PLN02998	1.13e-29	11	406	30	486	beta-glucosidase
PLN02849	PLN02849	1.94e-28	11	408	29	483	beta-glucosidase
PRK09852	PRK09852	2.24e-24	12	409	4	470	cryptic 6-phospho-beta-glucosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADW18818.1	8.94e-153	1	425	1	432
AVM43515.1	3.91e-145	1	425	1	417
ADQ08048.1	1.47e-137	1	425	1	426
QCX34294.1	1.22e-132	1	425	1	424
QNM13665.1	3.61e-119	1	425	1	424

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1VFF_A	8.37e-67	12	418	5	416	beta-glycosidasefrom Pyrococcus horikoshii [Pyrococcus horikoshii]
6Z1H_A	1.24e-58	8	409	7	449	ChainA, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1H_B Chain B, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1M_A Chain A, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_B Chain B, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_C Chain C, Ancestral reconstructed glycosidase [synthetic construct]
6IER_A	3.18e-53	16	398	36	421	Apostructure of a beta-glucosidase 1317 [uncultured bacterium]
4R27_A	2.80e-49	12	398	7	402	Crystalstructure of beta-glycosidase BGL167 [Microbacterium sp. Gsoil167],4R27_B Crystal structure of beta-glycosidase BGL167 [Microbacterium sp. Gsoil167]
7E5J_A	1.02e-45	11	405	5	441	ChainA, Beta-glucosidase [Thermoanaerobacterium saccharolyticum JW/SL-YS485]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P22505	8.08e-43	10	410	6	448	Beta-glucosidase B OS=Paenibacillus polymyxa OX=1406 GN=bglB PE=1 SV=1
P26208	1.12e-42	12	410	6	448	Beta-glucosidase A OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglA PE=1 SV=1
P10482	1.22e-39	11	409	4	455	Beta-glucosidase A OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=bglA PE=3 SV=1
P22073	1.05e-38	10	408	4	442	Beta-glucosidase A OS=Paenibacillus polymyxa OX=1406 GN=bglA PE=1 SV=1
B9K7M5	6.90e-38	12	409	4	441	1,4-beta-D-glucan glucohydrolase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E) OX=309803 GN=gghA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000037	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003584_01159.