CAZyme Information: MGYG000003584_01578

Basic Information

• Species: HGM11412 sp900770185
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; HGM11412; HGM11412 sp900770185
• CAZyme ID: MGYG000003584_01578
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
780		87761.91	5.3285

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003584	1810421	MAG	Fiji	Oceania

• Gene Location: Start: 6775; End: 9117 Strand: +

Full Sequence      

MFLSKKFIAANYDVADFTNVVPAPYLRKTFNLDFTPESAEITICGLGFYELYINGVNITK
GALAPYISNPDDICYYDNYDVKSYLKTGKNAIGIVLGNGFRNSFGGFVWDFEKADCRGAV
CLALSFEAKSGDKSVTFEADESFKTHPSPLKRNDVRMGTLYDARDEIAGWNLPDFDDSSW
KNAVKITMPKGERKLCAVEPIKVYKVLKPVSVKFYDEIPLSYKTPESGAEPFPESFRKNV
YVYDFGLNSAGVSRLKIKGKRGQKITIHHGEYLQDGKFSLFTTMFEWHKDYKLYLDYGQC
DEYILKGDGLEVYTPVFKYDGFRYLCVEGLTPEQATLDAFEFLVMSSSLETRADFTCSDK
TLNTLYEMAVNSDKSNFYYFPTDCPHREKNGWTGDASMSCEHMLLHLRGEKSLEEWLNNV
RKAQKESGQIPGIVPTGGWGYSWGNGPVWDSVLFTLPLEIYRRTGDKKVINDNLEAMLRW
LSYAGTKRDDKGLLAFGLGDWVDPNEGINGKIAAPLELTDTVMTYLNAEIAEFLFGEVGR
TLEKHFAAEFKAELKKAIRTNLINFDTMTAAGDCQTSQAFTIFAKIFTDSEMPAAKRRLL
EIIHRDNDINACGMVGLRCIFRILCDMGEGDLAYKMIVYDGYSGYASWIKAGATALCEQF
FLFAGRGTGSQNHHFLGDILALFIEKFAGLNPNPYYNDKNYLLVTPDFISALNYAKASFD
FDSGKSYVSWERAGDKISLKITVPEGVRAELILPQGYALIEKTAKLIAGENEFTVVKIQN

Enzyme Prediction     

No EC number prediction in MGYG000003584_01578.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	237	753	7.2e-112	0.9900793650793651
CBM67	22	189	3.9e-31	0.8863636363636364

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	8.40e-67	355	683	6	336	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	7.76e-36	36	203	3	170	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	1.76e-22	237	346	4	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	1.63e-09	703	754	13	64	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGQ94103.1	2.00e-139	21	757	141	844
QGA24212.1	1.33e-121	22	754	155	861
QRQ48940.1	8.40e-121	23	775	155	880
AHF16194.1	1.00e-120	15	769	164	876
ANH83620.1	2.87e-120	22	761	139	849

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	1.14e-94	23	755	176	900	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	1.80e-61	8	754	283	995	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	1.39e-58	27	754	135	847	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WF03	8.23e-69	25	776	172	911	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KPL4	8.57e-69	23	755	184	908	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
Q82PP4	9.17e-61	8	754	283	995	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	7.87e-59	19	754	169	879	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999995	0.000050	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003584_01578.