CAZyme Information: MGYG000003585_00209

Basic Information

• Species: Acidaminococcus sp900770265
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Acidaminococcales; Acidaminococcaceae; Acidaminococcus; Acidaminococcus sp900770265
• CAZyme ID: MGYG000003585_00209
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
304		33708.28	8.1564

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003585	1967662	MAG	Fiji	Oceania

• Gene Location: Start: 2652; End: 3566 Strand: -

Full Sequence      

MPEPPIIDEILYFDKAAFGKMGWSERWETLKKTRELLHSKHFDLVIDLQGLFKSAVMAWL
TGCPNRIGYCEMREGSGLISKAITGPNAHKHVIERYLDVARYLGAKVDTITYPMPALTEE
MEVVRLRLIGAGIPDRKGPLPYVVFVPGARWDTKRWPLDHYAALAKKFLERGLYVVLAGG
PGDAPLGETILQQVGEDPRLIDFIGKTSLRELGALIKGARFYVSGDTGPLHIATALQKPL
VTMYGPTRPDRTGPYGNPNATVLLSPVDCAGCLKKHCDHWTCMGAVTPEQVFMDFLKKEG
KACD

Enzyme Prediction     

No EC number prediction in MGYG000003585_00209.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	34	279	1.4e-67	0.9466666666666667

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0859	RfaF	1.47e-67	5	292	50	323	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
cd03789	GT9_LPS_heptosyltransferase	8.75e-58	5	292	48	272	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
pfam01075	Glyco_transf_9	3.89e-57	37	277	8	241	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
TIGR02195	heptsyl_trn_II	4.97e-44	1	292	47	326	lipopolysaccharide heptosyltransferase II. This family consists of examples of ADP-heptose:LPS heptosyltransferase II, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK10916	PRK10916	4.24e-31	37	254	76	297	ADP-heptose--LPS heptosyltransferase RfaF.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADB48008.1	1.23e-177	1	304	48	350
AEQ22075.1	3.08e-136	1	304	32	332
QTV78223.1	7.15e-127	1	298	50	345
QNP77240.1	6.15e-122	1	298	48	340
BBG62450.1	7.10e-121	1	298	48	340

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1PSW_A	2.44e-25	31	264	70	307	Structureof E. coli ADP-heptose lps heptosyltransferase II [Escherichia coli]
2GT1_A	2.15e-22	15	266	64	300	E.coli heptosyltransferase WaaC. [Escherichia coli UTI89],2GT1_B E. coli heptosyltransferase WaaC. [Escherichia coli UTI89]
6DFE_A	2.15e-22	15	266	64	300	Thestructure of a ternary complex of E. coli WaaC [Escherichia coli],6DFE_B The structure of a ternary complex of E. coli WaaC [Escherichia coli]
2H1F_A	2.40e-22	15	266	64	300	E.coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1F_B E. coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1H_A E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218],2H1H_B E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218]
3TOV_A	1.11e-14	5	255	57	298	Thecrystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008],3TOV_B The crystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37692	1.96e-26	31	264	70	307	ADP-heptose--LPS heptosyltransferase 2 OS=Escherichia coli (strain K12) OX=83333 GN=rfaF PE=1 SV=1
P37421	1.38e-25	37	264	76	307	ADP-heptose--LPS heptosyltransferase 2 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaF PE=3 SV=1
P45042	1.18e-22	19	263	62	305	ADP-heptose--LPS heptosyltransferase 2 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=rfaF PE=3 SV=1
P24173	3.86e-21	15	266	64	300	Lipopolysaccharide heptosyltransferase 1 OS=Escherichia coli (strain K12) OX=83333 GN=rfaC PE=1 SV=1
P26469	4.16e-18	34	266	79	300	Lipopolysaccharide heptosyltransferase 1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003585_00209.