CAZyme Information: MGYG000003585_00232

Basic Information

• Species: Acidaminococcus sp900770265
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Acidaminococcales; Acidaminococcaceae; Acidaminococcus; Acidaminococcus sp900770265
• CAZyme ID: MGYG000003585_00232
• CAZy Family: GH18
• CAZyme Description: Putative sporulation-specific glycosylase YdhD

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
253		28760.64	5.2028

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003585	1967662	MAG	Fiji	Oceania

• Gene Location: Start: 76; End: 837 Strand: +

Full Sequence      

MWALITNGFDPDRTHGLLDNPAGRRKAVENLLQLAQTYQLDGINLDFENIKPEDSDRLTA
FVGELSGMLKPAGYTVSIDVTVPSDNGNWSKCYNRKDLAEQVDYVMLMAYDEHHRLSKTA
GSVASLPWVEQGIQKTLLEVPKEKLLLGMPLYMRDWTVKEDGTVSAKTLSMLGARKLIKE
NSLVPAWLSREGQYYFEYRDQGTLHKVWMEEGRSLALKNALISRYDLAGSAYWRKGLEEP
EVWEQAEAYNVSH

Enzyme Prediction     

No EC number prediction in MGYG000003585_00232.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	15	236	5.4e-39	0.6993243243243243

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02874	GH18_CFLE_spore_hydrolase	2.73e-89	2	244	62	311	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
COG3858	YaaH	1.95e-55	2	243	164	415	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].
cd06549	GH18_trifunctional	7.94e-34	5	243	65	298	GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain.
cd02875	GH18_chitobiase	4.28e-29	18	233	91	334	Chitobiase (also known as di-N-acetylchitobiase) is a lysosomal glycosidase that hydrolyzes the reducing-end N-acetylglucosamine from the chitobiose core of oligosaccharides during the ordered degradation of asparagine-linked glycoproteins in eukaryotes. Chitobiase can only do so if the asparagine that joins the oligosaccharide to protein is previously removed by a glycosylasparaginase. Chitobiase is therefore the final step in the lysosomal degradation of the protein/carbohydrate linkage component of asparagine-linked glycoproteins. The catalytic domain of chitobiase is an eight-stranded alpha/beta barrel fold similar to that of other family 18 glycosyl hydrolases such as hevamine and chitotriosidase.
smart00636	Glyco_18	1.30e-25	5	233	73	329	Glyco_18 domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADB47041.1	1.49e-139	1	249	113	360
QJW48079.1	1.29e-81	1	243	226	471
QIB60827.1	1.60e-81	1	243	97	339
SNU93874.1	1.65e-81	1	243	94	336
BDA10778.1	2.26e-81	1	243	97	339

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CZ8_A	1.69e-36	3	239	71	312	ChainA, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168],3CZ8_B Chain B, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168]
4S3J_A	3.09e-27	5	243	176	418	Crystalstructure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_B Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_C Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876]
4S3K_A	4.95e-24	3	243	175	420	ChainA, Spore germination protein YaaH [Priestia megaterium QM B1551]
5JH8_A	6.47e-23	22	243	87	307	Crystalstructure of chitinase from Chromobacterium violaceum ATCC 12472 [Chromobacterium violaceum ATCC 12472]
4Q6T_A	9.89e-18	9	243	83	332	Thecrystal structure of a class V chitininase from Pseudomonas fluorescens Pf-5 [Pseudomonas protegens Pf-5]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O05495	5.98e-35	3	234	163	399	Putative sporulation-specific glycosylase YdhD OS=Bacillus subtilis (strain 168) OX=224308 GN=ydhD PE=1 SV=2
O32258	2.29e-34	2	244	88	337	Uncharacterized glycosylase YvbX OS=Bacillus subtilis (strain 168) OX=224308 GN=yvbX PE=3 SV=1
P0DPJ9	6.24e-27	5	243	175	417	Cortical fragment-lytic enzyme OS=Bacillus anthracis OX=1392 GN=sleL PE=2 SV=1
Q9K3E4	1.64e-26	5	243	175	417	Cortical fragment-lytic enzyme OS=Bacillus cereus OX=1396 GN=sleL PE=1 SV=1
P37531	2.80e-24	1	243	166	416	Cortical fragment-lytic enzyme OS=Bacillus subtilis (strain 168) OX=224308 GN=sleL PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003585_00232.