CAZyme Information: MGYG000003585_00556

Basic Information

• Species: Acidaminococcus sp900770265
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Acidaminococcales; Acidaminococcaceae; Acidaminococcus; Acidaminococcus sp900770265
• CAZyme ID: MGYG000003585_00556
• CAZy Family: GT25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
263		30353.33	9.8382

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003585	1967662	MAG	Fiji	Oceania

• Gene Location: Start: 8170; End: 8961 Strand: -

Full Sequence      

MNHFFHYVISAKPMSKRKERMLERFAKWGMKPNFFDAIMGNQLSKEELEKLSASEGLLTL
GEIGCALSHLGVYQKLLASKEPCVYVFEDDALLTDEFIELQPKIQQFMERQTKPTVLVLC
AINGRKKVCQKLNGQVSIMRSLAGTRAHAYVLNRAAARNLLKAQTPVKIELDAWAIYQKL
GFIRLYCLNQNVVGLDGELEKASTIDQIATRHTRDAKVIQRIKDKHVKNWFHHLTTTEKI
AFFGRRISRHIKELYYENNEENL

Enzyme Prediction     

No EC number prediction in MGYG000003585_00556.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT25	7	172	2.7e-26	0.9558011049723757

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06532	Glyco_transf_25	2.24e-23	7	174	3	127	Glycosyltransferase family 25 [lipooligosaccharide (LOS) biosynthesis protein] is a family of glycosyltransferases involved in LOS biosynthesis. The members include the beta(1,4) galactosyltransferases: Lgt2 of Moraxella catarrhalis, LgtB and LgtE of Neisseria gonorrhoeae and Lic2A of Haemophilus influenzae. M. catarrhalis Lgt2 catalyzes the addition of galactose (Gal) to the growing chain of LOS on the cell surface. N. gonorrhoeae LgtB and LgtE link Gal-beta(1,4) to GlcNAc (N-acetylglucosamine) and Glc (glucose), respectively. The genes encoding LgtB and LgtE are two genes of a five gene locus involved in the synthesis of gonococcal LOS. LgtE is believed to perform the first step in LOS biosynthesis.
pfam01755	Glyco_transf_25	1.46e-21	7	172	5	197	Glycosyltransferase family 25 (LPS biosynthesis protein). Members of this family belong to Glycosyltransferase family 25 This is a family of glycosyltransferases involved in lipopolysaccharide (LPS) biosynthesis. These enzymes catalyze the transfer of various sugars onto the growing LPS chain during its biosynthesis.
COG3306	COG3306	1.15e-15	3	251	2	255	Glycosyltransferase involved in LPS biosynthesis, GR25 family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEQ21321.1	7.75e-67	4	257	3	256
QQJ90846.1	2.32e-37	6	206	3	205
QEH18106.1	2.32e-37	6	206	3	205
QEH51070.1	2.53e-36	6	206	3	205
QEH26877.1	2.53e-36	6	206	3	205

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q57394	8.16e-08	6	160	4	166	Lipooligosaccharide biosynthesis protein lic2B OS=Haemophilus influenzae OX=727 GN=lic2B PE=3 SV=1
Q17FB8	1.17e-07	7	90	326	419	Glycosyltransferase 25 family member OS=Aedes aegypti OX=7159 GN=AAEL003481 PE=3 SV=1
A7MB73	1.56e-07	7	164	323	491	Probable inactive glycosyltransferase 25 family member 3 OS=Bos taurus OX=9913 GN=CERCAM PE=2 SV=1
Q5U309	6.65e-07	7	164	300	468	Probable inactive glycosyltransferase 25 family member 3 OS=Rattus norvegicus OX=10116 GN=Cercam PE=2 SV=2
A3KGW5	2.16e-06	7	164	320	488	Inactive glycosyltransferase 25 family member 3 OS=Mus musculus OX=10090 GN=Cercam PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003585_00556.