CAZyme Information: MGYG000003585_01080

Basic Information

• Species: Acidaminococcus sp900770265
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Acidaminococcales; Acidaminococcaceae; Acidaminococcus; Acidaminococcus sp900770265
• CAZyme ID: MGYG000003585_01080
• CAZy Family: CBM48
• CAZyme Description: 1,4-alpha-glucan branching enzyme GlgB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
658		75812.72	5.9206

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003585	1967662	MAG	Fiji	Oceania

• Gene Location: Start: 8959; End: 10935 Strand: +

Full Sequence      

MKRSAIDEYSTFLYHQGTNYESYRLFGAHFTVYKRKPCVRFALWAPHAQKVSVVGDFNGW
DPAAHPMEKSPLGNGVWVAYIPGLKEGDLYKYAITTASGEEILKSDPYAFWSEVRPNTAS
RLTKLTYRWHDQKWQKERPAYDSYHNPMLTYEVHLGSWRRGEEGRLLTYREIAPQLVDYV
KEMHYTHIELMPLCEYPFDGSWGYQATGYFSATSRYGKPEDFMYLVDLCHKNGIGVILDW
VPGHYCRDAHGLRLFDGEPCYESGNPNLAENKEWDTMNFDYGRTEVQSFLISSALFWLKE
FHLDGLRIDAVANMLYLDYGKKPGEWTPNRNGGHENLEAVAFLQKLNTAVFQEVPSALMI
AEESTAWPMVTRPVSDGGLGFNYKWNMGWMNDMLEYMSMDPLFRKDHQNLITFSLCYAFS
ENFILPLSHDEMVHGKKSLLDKMPGDYWQKFAGLRAFYGYWMTHPGKKLLFMGADYGQFI
EWKYDDSLDWHLLKYPMHAAMHKYVQTLNGYYGAHKELWEEDYDWKGFQWISCDDCDNSV
IAFYRLAKDGKTMTVVVCNFTPVVRHNYRIGAPRPGVYQEVLNSDATEFGGSGVLNSGDL
ITEAIPMHGRPQSLELTLPPLGTIYLQLVKEGEPNENPEDKKDPRPAEAGKAGSADRD

Enzyme Prediction     

EC	2.4.1.18

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH13	178	478	3.8e-156	0.9966777408637874
CBM48	26	110	1.2e-20	0.868421052631579

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK12313	PRK12313	0.0	13	630	14	629	1,4-alpha-glucan branching protein GlgB.
PRK14706	PRK14706	0.0	25	639	26	638	glycogen branching enzyme; Provisional
PRK14705	PRK14705	0.0	6	626	603	1220	glycogen branching enzyme; Provisional
COG0296	GlgB	0.0	6	628	6	628	1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism].
PRK05402	PRK05402	0.0	3	631	97	726	1,4-alpha-glucan branching protein GlgB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCC74190.1	0.0	1	629	1	629
AVO75118.1	0.0	1	629	1	629
AVO27861.1	0.0	1	629	1	629
ALG42393.1	0.0	1	629	1	629
AXL20084.1	0.0	1	628	1	628

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5GQW_A	2.13e-236	12	639	135	780	Crystalstructure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GQX_A Crystal structure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]
5GQZ_A	4.28e-236	12	639	135	780	Crystalstructure of branching enzyme Y500A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]
5GR5_A	6.06e-236	12	639	135	780	Crystalstructure of branching enzyme W610A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]
5GR2_A	8.59e-236	12	639	135	780	Crystalstructure of branching enzyme L541A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GR4_A Crystal structure of branching enzyme L541A mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]
5GQU_A	1.22e-235	12	639	135	780	Crystalstructure of branching enzyme from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GQV_A Crystal structure of branching enzyme from Cyanothece sp. ATCC 51142 in complex with maltohexaose [Crocosphaera subtropica ATCC 51142],5GQY_A Crystal structure of branching enzyme from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B8CVY1	5.71e-283	1	631	1	630	1,4-alpha-glucan branching enzyme GlgB OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) OX=373903 GN=glgB PE=3 SV=1
O66936	1.47e-251	2	627	3	627	1,4-alpha-glucan branching enzyme GlgB OS=Aquifex aeolicus (strain VF5) OX=224324 GN=glgB PE=3 SV=1
Q8CZE8	5.36e-251	12	633	10	632	1,4-alpha-glucan branching enzyme GlgB OS=Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831) OX=221109 GN=glgB PE=3 SV=1
Q2RR72	1.10e-248	5	627	109	731	1,4-alpha-glucan branching enzyme GlgB OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1) OX=269796 GN=glgB PE=3 SV=1
Q24VW3	2.41e-248	12	627	18	628	1,4-alpha-glucan branching enzyme GlgB OS=Desulfitobacterium hafniense (strain Y51) OX=138119 GN=glgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003585_01080.