CAZyme Information: MGYG000003585_01637

Basic Information

• Species: Acidaminococcus sp900770265
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Acidaminococcales; Acidaminococcaceae; Acidaminococcus; Acidaminococcus sp900770265
• CAZyme ID: MGYG000003585_01637
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
364	MGYG000003585_245|CGC1	39521.4	7.9542

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003585	1967662	MAG	Fiji	Oceania

• Gene Location: Start: 2800; End: 3894 Strand: -

Full Sequence      

MHAAALTRAILQQDPSAQVFGMGGEALAAAGGEVVFNYKEYSVMGFVEVVKALPKLFGLK
KAFRRLMEERKPDVFVTVDYPDFNMRVAREAKTLGIPVFSYIPPSAWAWRRGRAKMVAKL
CTKVACIYPFAAKVYEEAGAPVEFVGNPLVDIVQPELSPQEGEALIGKRAGHPVVLLLPG
SRVKEITGVLPVMLQALPLIKKQRPDVDFVLQKAPSIERGLLDSILAQSTEPVKVVEGHN
YDVMTASDVALATSGTVTLEAALCGLPTVICYCASALSIFLARHLVYVKYCGLPNILAGK
EILPELIQEDMTPERMASSVLAFLEPEGAEHVRRELQQAVAKLGKPGAVDRTAALILKTA
KEKE

Enzyme Prediction     

No EC number prediction in MGYG000003585_01637.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	1	338	3.8e-112	0.9463276836158192

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	1.52e-110	1	364	15	379	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	7.46e-98	2	362	16	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	6.41e-79	2	356	13	373	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
PRK14089	PRK14089	8.09e-49	39	314	46	307	lipid-A-disaccharide synthase.
PRK01021	lpxB	4.78e-35	6	338	245	584	lipid-A-disaccharide synthase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADB48042.1	6.11e-212	1	362	15	376
AEQ21864.1	9.15e-174	1	364	14	377
QTV78315.1	5.94e-135	1	364	20	383
BBG63223.1	2.03e-134	1	364	15	378
QNP77898.1	2.03e-134	1	364	15	378

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	6.05e-50	4	340	23	365	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	1.67e-49	4	340	23	365	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2LVL8	1.33e-84	1	364	17	382	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q74AT9	6.89e-82	1	357	20	377	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
Q39T49	1.38e-81	1	363	20	383	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
Q2IL69	1.33e-78	1	357	22	379	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) OX=290397 GN=lpxB PE=3 SV=1
B8JE78	7.47e-78	1	357	22	379	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) OX=455488 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003585_01637.