CAZyme Information: MGYG000003586_01865

Basic Information

• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelotrichaceae; Bulleidia
• CAZyme ID: MGYG000003586_01865
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
485	MGYG000003586_560|CGC1	56445.62	5.8696

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003586	2345060	MAG	Fiji	Oceania

• Gene Location: Start: 805; End: 2262 Strand: +

Full Sequence      

MNSGFPENFLWGGATAASQVEGGFDQGGKGLDTQDCKPQYFNLTSKEKNDWKYKQMTSEK
YELAKTVKGIANYPFRFGSQEYTHYKEDIALFAEMGMKIYRMSISWARIYPNGDDAEPNQ
EGLQYYRNVFNECHKHGIKVFVTILHYAIPVHLVDAYGGWKNRRLIDFYVKYAKTLFENF
RDDVDYWLPFNEINAGRFNPYNGVALIKDREKNYDQAVYQSLHHQFVANAKVVKLAHEMI
PGSKLGCMIARFCHYPATCDPMDQLTWLHDEQYTNWFYTDVMARGAYPKYMLRYFDENNI
QIHMEPGDEELLKNYTVDFISFSYYFTQVSTAKDDWAKTDGNLVIANKNPYLKSSEWGWQ
MDPTGLRITLNELYDRYQKPLFVAENGLGARDVVEDGKIHDPYRSEYLLSHAKAMKEAIK
DGVDLFGYTWWGIIDLVSCGSIEMCKRYGMIYVDADDEGHGTFNRLKKDSFYTYQHLIET
NGAEL

Enzyme Prediction     

EC	3.2.1.86	3.2.1.21	3.2.1.37

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	1	482	7.5e-134	0.9953379953379954

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09852	PRK09852	0.0	2	485	1	473	cryptic 6-phospho-beta-glucosidase; Provisional
COG2723	BglB	0.0	5	482	4	454	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	0.0	5	485	6	477	6-phospho-beta-glucosidase; Reviewed
PRK09589	celA	3.34e-175	3	485	2	476	6-phospho-beta-glucosidase; Reviewed
PRK15014	PRK15014	6.31e-147	5	485	6	477	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEF34955.1	8.21e-236	5	485	9	489
QGT97346.1	8.21e-236	5	485	9	489
QNM12924.1	1.10e-223	1	485	1	487
VEA68230.1	1.01e-221	1	485	1	486
QOY61128.1	6.65e-216	1	485	2	489

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	1.01e-179	5	485	8	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
4IPL_A	1.34e-151	5	485	20	485	Thecrystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPL_B The crystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_B The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_E The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4]
2XHY_A	5.47e-141	6	485	9	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
4F66_A	8.00e-141	3	485	5	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	2.27e-140	3	485	5	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40740	1.19e-180	5	485	8	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
P24240	1.07e-162	5	485	4	473	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
Q46130	1.08e-154	5	485	7	471	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
P26206	3.82e-153	1	485	1	463	6-phospho-beta-glucosidase OS=Dickeya chrysanthemi OX=556 GN=arbB PE=3 SV=1
Q48409	1.49e-152	5	485	4	462	Phospho-cellobiase OS=Klebsiella oxytoca OX=571 GN=casB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000036	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003586_01865.