CAZyme Information: MGYG000003589_00177

Basic Information

• Species: Dysosmobacter sp900770295
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; Dysosmobacter; Dysosmobacter sp900770295
• CAZyme ID: MGYG000003589_00177
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
549	MGYG000003589_13|CGC1	60747.61	4.0141

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003589	2941827	MAG	Fiji	Oceania

• Gene Location: Start: 9435; End: 11084 Strand: +

Full Sequence      

MHHIRLPKRLLSTALAAALALTPAAAFSDTSGHWAETSISKWSEEYSIIQGYEDGTFRPD
QSITRGAFAGIMDRFLQFQSISGPDTFSDIAGNYWENAILKLHAAGVYLGNNGKALAGDT
ITRQQAVAMIARAFQIEASAIDLPYGDAGQIADYAAGPVSEMTIRGYITDCPDGNFRPQE
PITRAEIINILSNMIQTLIQNTGVYSGDVQGTLMINAPDGASLENMTIYGDLILAPGVTG
EVSLTNVTVMGNIRNFSRTEPVYLYPQEAEEPEKPEEPEAPAIQPGEVYTPGETTGQYIM
YSGKQIPIYEEREPIRLYEGDFYWEDDRLVYVGEEFQRTRFGIDVSAYQNRASENNTIDW
EAVANDGVEFVMVRAGLRGTSSGQILADSFYKENIQGAMDAGLETGVYFFAQAVTVEEAI
EEADFVISLLDGLEINGPVAYDWEMHDSSYRVYGTSPEMATACAVAFCERIEEAGYEAVV
YAGQYVSYIKYDQGAISPYLSWYPEYKSASSEKLYPTFYYQMDYWQFSSNCSVDGIGGRV
DGNLQFIPW

Enzyme Prediction     

No EC number prediction in MGYG000003589_00177.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	343	536	2.6e-36	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06414	GH25_LytC-like	2.05e-62	340	546	1	191	The LytC lysozyme of Streptococcus pneumoniae is a bacterial cell wall hydrolase that cleaves the beta1-4-glycosydic bond located between the N-acetylmuramoyl-N-glucosaminyl residues of the cell wall polysaccharide chains. LytC is composed of a C-terminal glycosyl hydrolase family 25 (GH25) domain and an N-terminal choline-binding module (CBM) consisting of eleven homologous repeats that specifically recognizes the choline residues of pneumococcal lipoteichoic and teichoic acids. This domain arrangement is the reverse of the major pneumococcal autolysin, LytA, and the CPL-1-like lytic enzymes of the pneumococcal bacteriophages, in which the CBM (consisting of six repeats) is at the C-terminus. This model represents the C-terminal catalytic domain of the LytC-like enzymes.
cd00599	GH25_muramidase	3.38e-26	342	544	2	185	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
pfam01183	Glyco_hydro_25	1.02e-18	343	536	1	180	Glycosyl hydrolases family 25.
cd06525	GH25_Lyc-like	3.80e-16	342	543	2	182	Lyc muramidase is an autolytic lysozyme (autolysin) from Clostridium acetobutylicum encoded by the lyc gene. Lyc has a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
COG3757	Acm	5.99e-15	342	543	65	251	Lyzozyme M1 (1,4-beta-N-acetylmuramidase), GH25 family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCK85948.1	1.20e-278	14	548	14	549
QCI60549.1	3.72e-267	19	547	20	544
QUO37824.1	1.34e-265	5	546	5	556
QNL45744.1	2.10e-198	14	548	12	544
BAK99312.1	1.64e-197	14	548	14	543

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4KRU_A	5.65e-11	342	543	22	205	X-raystructure of catalytic domain of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
4KRT_A	1.87e-10	342	543	22	205	X-raystructure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101],4KRT_B X-ray structure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
5A6S_A	3.13e-06	355	541	31	197	Crystalstructure of the CTP1L endolysin reveals how its activity is regulated by a secondary translation product [Clostridium phage phiCTP1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P38536	1.85e-13	27	196	1682	1856	Amylopullulanase OS=Thermoanaerobacterium thermosulfurigenes OX=33950 GN=amyB PE=3 SV=2
P38535	1.35e-11	27	196	908	1082	Exoglucanase XynX OS=Acetivibrio thermocellus OX=1515 GN=xynX PE=3 SV=1
P19424	1.68e-11	45	251	59	266	Endoglucanase OS=Bacillus sp. (strain KSM-635) OX=1415 PE=1 SV=1
Q06852	1.16e-08	44	196	2099	2265	Cell surface glycoprotein 1 OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=olpB PE=3 SV=2
P36917	3.68e-07	20	125	1049	1154	Endo-1,4-beta-xylanase A OS=Thermoanaerobacterium saccharolyticum OX=28896 GN=xynA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000492	0.998517	0.000259	0.000298	0.000222	0.000193

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003589_00177.