CAZyme Information: MGYG000003589_00613

Basic Information

• Species: Dysosmobacter sp900770295
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; Dysosmobacter; Dysosmobacter sp900770295
• CAZyme ID: MGYG000003589_00613
• CAZy Family: GT1
• CAZyme Description: Demethyllactenocin mycarosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
387	MGYG000003589_54|CGC1	42871.14	6.6304

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003589	2941827	MAG	Fiji	Oceania

• Gene Location: Start: 4887; End: 6050 Strand: +

Full Sequence      

MSRIAFFCIPAWGHTNPTVEVVRALTEQGHQVRYYSFAPFREKLEDAGAEVILCDEALPP
APPDLDRRVGRDFTALVQMVTDTTLALENKVCRELETFGPDVIVSDSVCFWGKLFAGKLG
VPYVCSTTTFAFNQHSAQRMTPTAGETLRSLVGMPRVGRCMALLRRHGYPVKGLLDLIQN
DNETDTIVYTSRAFQPMAETFSDRYAFVGPSLPERALAEQPPKARPLVYISLGTVMNRRM
DFYRSCIAALGQEPLDVVMSVGESVDPASLSPAPANFRIERRVDQLAVLARADVFLTHCG
MNSANEAIWFGVPTVLYPQQSEEAAVADRMEELGLGLRLKDASAIRETVRQVLTEPGYRE
RTRAMGETFRSAGGPARAAEKILSCRR

Enzyme Prediction     

No EC number prediction in MGYG000003589_00613.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	19	383	5e-47	0.9162303664921466

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR01426	MGT	1.37e-109	7	383	1	387	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
cd03784	GT1_Gtf-like	1.72e-62	3	382	2	401	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
COG1819	YjiC	3.60e-60	1	385	1	398	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
PLN02554	PLN02554	2.61e-09	285	381	352	470	UDP-glycosyltransferase family protein
cd03785	GT28_MurG	6.98e-09	211	383	167	348	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQR05406.1	2.47e-153	1	382	1	384
ANU41723.1	2.47e-153	1	382	1	384
QIA30433.1	9.99e-153	1	382	1	384
QUH20268.1	7.08e-152	1	384	1	385
QDM45718.1	1.11e-150	1	384	1	387

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6KQW_A	3.83e-62	3	382	5	381	ChainA, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168]
6KQX_A	4.36e-62	3	382	5	381	ChainA, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168],7BOV_A Chain A, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168]
2IYA_A	2.47e-52	3	383	14	416	Thecrystal structure of macrolide glycosyltransferases: A blueprint for antibiotic engineering [Streptomyces antibioticus],2IYA_B The crystal structure of macrolide glycosyltransferases: A blueprint for antibiotic engineering [Streptomyces antibioticus]
3IA7_A	5.02e-48	3	382	6	393	CrystalStructure of CalG4, the Calicheamicin Glycosyltransferase [Micromonospora echinospora],3IA7_B Crystal Structure of CalG4, the Calicheamicin Glycosyltransferase [Micromonospora echinospora]
6J31_A	2.45e-46	2	382	5	390	CrystalStructure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_B Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_C Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_D Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34539	2.39e-61	3	382	5	381	NDP-glycosyltransferase YjiC OS=Bacillus subtilis (strain 168) OX=224308 GN=yjiC PE=1 SV=1
Q65JC2	6.63e-58	2	382	4	386	NDP-glycosyltransferase YjiC OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46) OX=279010 GN=yjiC PE=1 SV=1
O31853	1.43e-54	1	383	1	393	Uncharacterized UDP-glucosyltransferase YojK OS=Bacillus subtilis (strain 168) OX=224308 GN=yojK PE=3 SV=2
O05496	7.77e-50	1	382	1	386	Uncharacterized UDP-glucosyltransferase YdhE OS=Bacillus subtilis (strain 168) OX=224308 GN=ydhE PE=3 SV=2
Q9XC67	1.71e-48	1	382	58	453	Demethyllactenocin mycarosyltransferase OS=Streptomyces fradiae OX=1906 GN=tylCV PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003589_00613.