CAZyme Information: MGYG000003589_02552

Basic Information

• Species: Dysosmobacter sp900770295
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; Dysosmobacter; Dysosmobacter sp900770295
• CAZyme ID: MGYG000003589_02552
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
194		21839.77	7.9814

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003589	2941827	MAG	Fiji	Oceania

• Gene Location: Start: 15489; End: 16073 Strand: -

Full Sequence      

MRLTPMRYKEFTWPHNPEIYTVEYRRQMAAHKVPFGRCVLQDLGYTYRVLKGEGVFTGND
AYRRFQELAAVFQESGPGLLVHPVWQAERAYFVELKVTEEPLPDYVRYSFTFWEDWNGYS
GGLTASDDGGALSGTGSKTTAAKSAAAETYTVRKGDTLWGIAKRYDVTLAALIAANPQIK
NPNLIYPGDKVLIP

Enzyme Prediction     

No EC number prediction in MGYG000003589_02552.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM50	150	194	3.4e-17	0.975

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02899	spore_safA	3.35e-18	152	194	1	43	spore coat assembly protein SafA. SafA (YrbB) (SafA) of Bacillus subtilis is a protein found at the interface of the spore cortex and spore coat, and is dependent on SpoVID for its localization. This model is based on the N-terminal LysM (lysin motif) domain (see pfamAM model pfam01476) of SafA and, from several other spore-forming species, the protein with the most similar N-terminal region. However, this set of proteins differs greatly in C-terminal of the LysM domaim; blocks of 12-residue and 13-residue repeats are found in the Bacillus cereus group, tandem LysM domains in Thermoanaerobacter tengcongensis MB4, etc. in which one of which is found in most examples of endospore-forming bacteria. [Cellular processes, Sporulation and germination]
cd00118	LysM	1.65e-17	149	193	2	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
smart00257	LysM	7.67e-16	149	193	1	44	Lysin motif.
pfam01476	LysM	9.32e-16	150	194	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
COG1388	LysM	1.02e-09	149	194	68	111	LysM repeat [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCK83823.1	3.79e-87	1	194	1	189
BAK99092.1	1.41e-80	1	193	1	190
QUO39535.1	3.96e-79	6	194	1	186
QCI61061.1	3.89e-77	6	194	1	187
QQR07698.1	1.02e-69	6	191	1	182

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4B8V_A	5.42e-06	150	194	117	161	ChainA, Extracellular Protein 6 [Fulvia fulva],4B9H_A Chain A, Extracellular Protein 6 [Fulvia fulva]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8GFE2	1.55e-08	143	193	60	110	Chlorophenol reductase OS=Desulfitobacterium hafniense OX=49338 PE=1 SV=1
Q6B4J5	7.63e-07	152	194	6	48	Spore coat assembly protein ExsA OS=Bacillus cereus OX=1396 GN=exsA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000038	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003589_02552.