CAZyme Information: MGYG000003589_02572

Basic Information

• Species: Dysosmobacter sp900770295
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; Dysosmobacter; Dysosmobacter sp900770295
• CAZyme ID: MGYG000003589_02572
• CAZy Family: GH18
• CAZyme Description: Spore germination protein YaaH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
426	MGYG000003589_157|CGC1	46583.76	4.402

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003589	2941827	MAG	Fiji	Oceania

• Gene Location: Start: 31421; End: 32701 Strand: +

Full Sequence      

MMVHVVQSGESVASIAMHYGVDPGRLAADNSVPADGALAVGQTLVVRFPRQVHAVQAGET
LTSIAAAYGTSVRQLWRNNWPLGGTEDLSPGQVLVISYWDERLGAASFNGYAYPYIDPAL
LSAQLPYVTYLTPFTYGITAGGGLLPLEDDAMLSAARQRGTAPVMHLSTLTESGQFDTQR
AEVVLTDFEVQDRLISEVLETVLRKGFAGLDVDFEYLPGELAEAYAAFLARLQRLLHSRG
LFVWAALASKTSALQPGLLYEGHNYAAVGAATDGVLLMTYEWGYTYGPPMAVAPLPNVRA
VLDYAITEIPAEKIFLGIPNYGYDWPLPFIQGVTRAQSISNQRAIELAVEYGVAIQYDET
AQSPFFYYTDAGGTVHEVWFEDARSMSAKLRLIAEYGFQGGGFWNLMRPFSQTWLVLDAL
YDVDGR

Enzyme Prediction     

No EC number prediction in MGYG000003589_02572.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	181	406	8e-37	0.6993243243243243

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02874	GH18_CFLE_spore_hydrolase	1.70e-120	109	417	5	313	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
COG3858	YaaH	1.73e-107	1	417	1	418	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].
cd06549	GH18_trifunctional	7.56e-29	150	406	50	290	GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain.
smart00636	Glyco_18	2.34e-25	95	406	2	331	Glyco_18 domain.
cd02875	GH18_chitobiase	1.42e-19	166	405	55	335	Chitobiase (also known as di-N-acetylchitobiase) is a lysosomal glycosidase that hydrolyzes the reducing-end N-acetylglucosamine from the chitobiose core of oligosaccharides during the ordered degradation of asparagine-linked glycoproteins in eukaryotes. Chitobiase can only do so if the asparagine that joins the oligosaccharide to protein is previously removed by a glycosylasparaginase. Chitobiase is therefore the final step in the lysosomal degradation of the protein/carbohydrate linkage component of asparagine-linked glycoproteins. The catalytic domain of chitobiase is an eight-stranded alpha/beta barrel fold similar to that of other family 18 glycosyl hydrolases such as hevamine and chitotriosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCK83840.1	3.09e-242	1	423	1	423
QCI61058.1	7.01e-234	1	424	1	424
QUO39116.1	5.44e-217	1	423	1	423
QQR05785.1	5.88e-169	1	423	1	423
ANU41359.1	5.88e-169	1	423	1	423

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4S3K_A	7.93e-81	3	426	6	432	ChainA, Spore germination protein YaaH [Priestia megaterium QM B1551]
4S3J_A	4.70e-71	6	417	8	421	Crystalstructure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_B Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_C Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876]
3CZ8_A	6.90e-62	104	406	9	308	ChainA, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168],3CZ8_B Chain B, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168]
5JH8_A	1.74e-26	106	417	6	310	Crystalstructure of chitinase from Chromobacterium violaceum ATCC 12472 [Chromobacterium violaceum ATCC 12472]
4WIW_A	1.37e-22	94	404	5	327	ChainA, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_B Chain B, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_C Chain C, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_D Chain D, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_E Chain E, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_F Chain F, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37531	3.93e-83	1	423	1	425	Cortical fragment-lytic enzyme OS=Bacillus subtilis (strain 168) OX=224308 GN=sleL PE=1 SV=2
P0DPJ9	1.20e-70	6	417	7	420	Cortical fragment-lytic enzyme OS=Bacillus anthracis OX=1392 GN=sleL PE=2 SV=1
Q9K3E4	9.30e-70	6	417	7	420	Cortical fragment-lytic enzyme OS=Bacillus cereus OX=1396 GN=sleL PE=1 SV=1
O05495	1.96e-65	1	416	1	411	Putative sporulation-specific glycosylase YdhD OS=Bacillus subtilis (strain 168) OX=224308 GN=ydhD PE=1 SV=2
O32258	8.31e-21	117	417	38	339	Uncharacterized glycosylase YvbX OS=Bacillus subtilis (strain 168) OX=224308 GN=yvbX PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000005	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003589_02572.