CAZyme Information: MGYG000003590_00117

Basic Information

• Species: Sodaliphilus sp900770215
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Sodaliphilus; Sodaliphilus sp900770215
• CAZyme ID: MGYG000003590_00117
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
537	MGYG000003590_11|CGC1	60657.27	9.9025

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003590	3134564	MAG	Fiji	Oceania

• Gene Location: Start: 1795; End: 3408 Strand: +

Full Sequence      

MKERHLLILLALLVVTTFFVNNSALPTDIMEARNLVTAREIVADGNWMVPTMNGELRLEK
PPLPTWVAAAIESVAPDNLAAQRVAPGIMGVVWTVYLVLLATKVSRRRKLGYMAGIVFLT
CYQIVLMGRTATWDIYCHAFMTGAIYYLYCGLSEDRSRQWRYFPAAGIMMGLSFLSKGPV
SFYALLLPWLVAAIGTLRLSARGKWKGLTCMIVLCLALSAAWYIYLYVFEPEAVQRVIGK
ETGSWTHRNVRPWWYYWRYFAEMGIWALLTLAALALRYWKRVLPEWRTYMMAALWTIACV
VLLSFMPEKKYRYLLPVMAPCAIAVACLVEHMQEADDKASIVLWQVHRWLIAAVVIAMPV
AVWVMKLLPVWQTVMLTVLCLALAVYEASPLRGGGRPWRLLLGAAGAFMLIECFLMGSIA
KIMGNPGSHSIAATRNMPRLHGLPFYFPQGDSLRIEIVYQAHRKILPLNMADSANVVNHT
PMVLVSTRWNSAVLSPAILSQVDTMLVGTYNDNTRPRGSRHYQQCFVNHVTIIKAKK

Enzyme Prediction     

No EC number prediction in MGYG000003590_00117.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	3	417	4.3e-66	0.7888888888888889

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	7.73e-26	18	385	22	395	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	5.56e-12	38	405	40	427	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	1.47e-11	60	216	2	155	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	0.006	53	231	54	239	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTV78033.1	1.25e-17	1	337	1	338
QGL17295.1	2.56e-17	2	329	13	350
ASY85472.1	2.56e-17	2	329	13	350
ASN02285.1	2.56e-17	2	329	13	350
ASY89677.1	2.56e-17	2	329	13	350

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	4.09e-09	31	446	59	496	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A8FRR0	3.45e-17	14	326	11	329	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Shewanella sediminis (strain HAW-EB3) OX=425104 GN=arnT PE=3 SV=1
C5BDQ8	9.16e-13	31	339	32	342	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Edwardsiella ictaluri (strain 93-146) OX=634503 GN=arnT PE=3 SV=1
A4SQX1	3.69e-12	31	350	30	348	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Aeromonas salmonicida (strain A449) OX=382245 GN=arnT PE=3 SV=1
A0KGY4	3.48e-11	31	350	30	348	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) OX=380703 GN=arnT PE=3 SV=1
A1JPM4	2.50e-10	22	326	25	331	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) OX=393305 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000749	0.998344	0.000369	0.000186	0.000172	0.000168

TMHMM  Annotations     

start	end
5	27
79	101
110	127
131	153
165	187
207	229
254	276
286	305
346	365
369	391
398	420