CAZyme Information: MGYG000003590_01168

Basic Information

• Species: Sodaliphilus sp900770215
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Sodaliphilus; Sodaliphilus sp900770215
• CAZyme ID: MGYG000003590_01168
• CAZy Family: GH16
• CAZyme Description: Beta-glucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
353		39491.52	4.5206

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003590	3134564	MAG	Fiji	Oceania

• Gene Location: Start: 2674; End: 3735 Strand: -

Full Sequence      

MYHYYSKSFLAVISIALVSFNSVAQHNYKLVWSDEFNDNALDEKAWNIEENGDGGGNNEL
QYYRGQNISFETDSASGAVCLVLTAKKESYNGKSFTSGRLNTAGKACFKHGKIVSRIKLP
STANGLWPAFWMLGNDYSSEGWPRCGEIDIVEMGNAEGIKHNTQDSFFNGACHWGYYNSQ
GQYPNYARSSTSTYSLQDGEFHTFTLEWDDDYVSMYLDQDKYPDVQPYFKMGVSDYSNDW
GTGNYFQHEFFIVYDLAVGGNFTGITSSAGITALAQGEAKMYVDWVRVYQDADDLTATAT
IPEGWGAGIDNVATTTSDKPVVIYDTLGNIVSEMNHGIYFVKKGDEVKKVFNR

Enzyme Prediction     

EC	3.2.1.39

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	32	289	1.9e-64	0.9956521739130435

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd08023	GH16_laminarinase_like	2.03e-67	32	289	1	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
cd02182	GH16_Strep_laminarinase_like	2.31e-33	28	290	2	259	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.
cd08024	GH16_CCF	6.31e-33	30	260	1	276	Coelomic cytolytic factor, member of glycosyl hydrolase family 16. Subgroup of glucanases of unknown function that are related to beta-GRP (beta-1,3-glucan recognition protein), but contain active site residues. Beta-GRPs are one group of pattern recognition receptors (PRRs), also referred to as biosensor proteins, that complexes with pathogen-associated beta-1,3-glucans and then transduces signals necessary for activation of an appropriate innate immune response. Beta-GRPs are present in insects and lack all catalytic residues. This subgroup contains related proteins that still contain the active site and are widely distributed in eukaryotes. Their structures adopt a jelly roll fold with a deep active site channel harboring the catalytic residues, like those of other glycosyl hydrolase family 16 members.
COG2273	BglS	1.14e-24	27	289	40	263	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].
cd02180	GH16_fungal_KRE6_glucanase	4.88e-20	30	290	1	295	Saccharomyces cerevisiae KRE6 and related glucanses, member of glycosyl hydrolase family 16. KRE6 is a Saccharomyces cerevisiae glucanase that participates in the synthesis of beta-1,6-glucan, a major structural component of the cell wall. It is a golgi membrane protein required for normal beta-1,6-glucan levels in the cell wall. KRE6 is closely realted to laminarinase, a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIU93827.1	3.29e-110	28	290	51	312
BCS85795.1	7.91e-74	22	291	17	273
AEF82958.1	3.46e-66	24	290	41	314
QQO09996.1	2.14e-62	94	289	31	220
QPI53029.1	1.40e-54	13	290	188	433

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NBO_A	8.76e-49	30	288	36	271	Bacteroidesovatus mixed linkage glucan PUL (MLGUL) GH16 [Bacteroides ovatus],5NBO_B Bacteroides ovatus mixed linkage glucan PUL (MLGUL) GH16 [Bacteroides ovatus],5NBP_A Bacteroides ovatus mixed linkage glucan PUL (MLGUL) GH16 in complex with G4G4G3G Product [Bacteroides ovatus],5NBP_B Bacteroides ovatus mixed linkage glucan PUL (MLGUL) GH16 in complex with G4G4G3G Product [Bacteroides ovatus],6VHO_AAA Chain AAA, Glycosyl hydrolase family 16 [Bacteroides ovatus ATCC 8483],6VHO_BBB Chain BBB, Glycosyl hydrolase family 16 [Bacteroides ovatus ATCC 8483]
7KR6_AAA	6.78e-48	30	288	36	271	ChainAAA, Glycoside hydrolase family 16 protein [Bacteroides ovatus],7KR6_BBB Chain BBB, Glycoside hydrolase family 16 protein [Bacteroides ovatus]
4CRQ_A	6.88e-47	27	290	2	231	Crystalstructure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S [Zobellia galactanivorans],4CRQ_B Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S [Zobellia galactanivorans],4CTE_A Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S in complex with a thio-oligosaccharide [Zobellia galactanivorans],4CTE_B Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S in complex with a thio-oligosaccharide [Zobellia galactanivorans]
6JH5_A	1.81e-46	27	293	3	235	Structureof Marine bacterial laminarinase [Aquimarina]
6JHJ_A	1.40e-45	27	293	3	235	Structureof Marine bacterial laminarinase mutant-E135A [Aquimarina],6JIA_A Marine bacterial laminarinase mutant E135A complex with laminaritetraose [Aquimarina sp.],6M6P_A Structure of Marine bacterial laminarinase mutant E135A in complex with 1,3-beta-cellotriosyl-glucose [Aquimarina sp.]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q27082	1.21e-33	28	292	25	255	Clotting factor G alpha subunit OS=Tachypleus tridentatus OX=6853 PE=1 SV=1
P45798	1.27e-27	27	290	39	283	Beta-glucanase OS=Rhodothermus marinus OX=29549 GN=bglA PE=1 SV=1
C1IE32	4.66e-26	17	264	9	242	Glucan endo-1,3-beta-glucosidase OS=Cryptopygus antarcticus OX=187623 PE=1 SV=1
P23903	1.76e-23	30	291	425	681	Glucan endo-1,3-beta-glucosidase A1 OS=Niallia circulans OX=1397 GN=glcA PE=1 SV=1
Q9ZG90	1.08e-14	14	328	42	331	Keratan-sulfate endo-1,4-beta-galactosidase OS=Sphingobacterium multivorum OX=28454 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000653	0.998484	0.000345	0.000186	0.000178	0.000164

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003590_01168.