CAZyme Information: MGYG000003590_01605

Basic Information

• Species: Sodaliphilus sp900770215
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Sodaliphilus; Sodaliphilus sp900770215
• CAZyme ID: MGYG000003590_01605
• CAZy Family: GH97
• CAZyme Description: Glucan 1,4-alpha-glucosidase SusB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
674		75368.88	7.0418

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003590	3134564	MAG	Fiji	Oceania

• Gene Location: Start: 1158; End: 3182 Strand: +

Full Sequence      

MHKTMKLIVTLLAAVLAVPLALAHDVVASPDGHIKVTAGLKGGKPFYSVERDGRPVINTS
YLGFELDKGSLKDGFKVIARKRDSKCETWTQVWGEDKEVVNHYNELRLCLQQSKGAKLRL
DLVLRVFNDGFGLRYEFPKQAGLSEFKILDELTQVAMPVDAQAWTIPTQGTTYYEALWTK
APLSQKPEVSTPVTIEVSDSLYMVLHDAALVDYASLNYTPRQLPGAAVTLVASLTPWKNG
VKVYGQAPMVTPWRTCIIARTPGELITSRLMLNLNEPCKIADTSWITCGKYVGIWWGMHM
KDYTWSQGPKHGATTANTKRYIDFAAAHGMKGVLVEGWNYGWDGDWARDDKFNYTKPYPD
YDFEGLQRYALSRGVSLIAHNETGGFAKTYEDQLEAAFSLYERMGIHAVKTGYVNTLMDQ
REDQHSQYGIRHYLKVIEAAARHHIMVVNHEPAMPSGLCRTYPNLISGEGFRGQEWNAWS
ADGGNPPYHVTVLPFTRGLAGSMDFTPGIFNFTNKAMPGTHPQTTLAKQLAEYVLLYTPW
QMAADEIENYEGQPAFKFIEDVPTNFERTVVLNAKIGNYLTIARKDRDSDNWCIGSATDE
KARDLDLKLDFLDEGKPYVAHIYTDGPGADYRTNPYPVTFTTQAVKRGDVIRVHLAPSGG
AAMMIVPVKPVTNH

Enzyme Prediction     

No EC number prediction in MGYG000003590_01605.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH97	17	665	1.4e-220	0.9809825673534073

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam10566	Glyco_hydro_97	3.28e-131	282	563	1	278	Glycoside hydrolase 97. This domain is the catalytic region of the bacterial glycosyl-hydrolase family 97. This central part of the GH97 family protein sequences represents a typical and complete (beta/alpha)8-barrel or catalytic TIM-barrel type domain. The N- and C-terminal parts of the sequences, mainly consisting of beta-strands, form two additional non-catalytic domains. In all known glycosidases with the (beta-alpha)8-barrel fold, the amino acid residues at the active site are located on the C-termini of the beta-strands.
pfam14508	GH97_N	9.34e-79	29	277	1	235	Glycosyl-hydrolase 97 N-terminal. This N-terminal domain of glycosyl-hydrolase-97 contributes part of the active site pocket. It is also important for contact with the catalytic and C-terminal domains of the whole.
pfam14509	GH97_C	3.46e-25	569	666	4	97	Glycosyl-hydrolase 97 C-terminal, oligomerization. Glycosyl-hydrolase-97 is made up of three tightly linked and highly conserved globular domains. The C-terminal domain is found to be necessary for oligomerization of the whole molecule in order to create the active-site pocket and the Ca++-binding site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANR72243.1	1.52e-306	27	669	30	673
QUB45553.1	1.52e-306	27	669	30	673
QUB83811.1	9.75e-305	27	666	30	670
BBA29476.1	1.43e-304	27	669	30	673
AUI55290.1	9.54e-303	27	669	30	673

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HQ4_A	6.15e-193	27	663	3	656	AGlycoside Hydrolase Family 97 enzyme from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8],5HQA_A A Glycoside Hydrolase Family 97 enzyme in complex with Acarbose from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]
5HQC_A	6.15e-193	27	663	3	656	AGlycoside Hydrolase Family 97 enzyme R171K variant from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]
5HQB_A	1.74e-192	27	663	3	656	AGlycoside Hydrolase Family 97 enzyme (E480Q) in complex with Panose from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]
3WFA_A	1.91e-157	29	669	7	707	Catalyticrole of the calcium ion in GH97 inverting glycoside hydrolase [Bacteroides thetaiotaomicron],3WFA_B Catalytic role of the calcium ion in GH97 inverting glycoside hydrolase [Bacteroides thetaiotaomicron]
2JKA_A	1.97e-157	29	669	16	716	Nativestructure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JKA_B Native structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JKE_A Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with deoxynojirimycin [Bacteroides thetaiotaomicron VPI-5482],2JKE_B Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with deoxynojirimycin [Bacteroides thetaiotaomicron VPI-5482],2JKP_A Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with castanospermine [Bacteroides thetaiotaomicron VPI-5482],2JKP_B Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with castanospermine [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G8JZS4	3.77e-157	20	669	18	727	Glucan 1,4-alpha-glucosidase SusB OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=susB PE=1 SV=1
Q8A6L0	1.22e-64	28	665	26	661	Retaining alpha-galactosidase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_1871 PE=1 SV=1
D7CFN7	1.07e-49	49	670	63	625	Probable retaining alpha-galactosidase OS=Streptomyces bingchenggensis (strain BCW-1) OX=749414 GN=SBI_01652 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000498	0.998286	0.000354	0.000284	0.000278	0.000262

TMHMM  Annotations     

start	end
7	29