CAZyme Information: MGYG000003590_01818

Basic Information

• Species: Sodaliphilus sp900770215
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Sodaliphilus; Sodaliphilus sp900770215
• CAZyme ID: MGYG000003590_01818
• CAZy Family: GH171
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
416	MGYG000003590_78|CGC1	45591.79	8.9733

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003590	3134564	MAG	Fiji	Oceania

• Gene Location: Start: 50653; End: 51903 Strand: -

Full Sequence      

MNFFRIALLSAACLSMMASAACTSGTSRSSAPAAKPAAAGQESSQVIVGAARTSEYVPLL
KGKRIALLSNQTGIVGDKHVLDIMLEQGLQVVTIFSPEHGFRGKADAGEKVASGVDEKTG
IPIASLYDGKSPMPSKETMDKCDVVVIDLQDVGLRFYTYYVTMIHLMDAAAHYGKQVVVL
DRPNPNGMTVDGPILDMKLKSGVGYLPIPTVYGMTMGELARMANGEGWLQDGKRVDLTVI
PCLNYTHRTRYKLPVAPSPNLPNMLSVYLYPSLCYFEGTTVSLGRGTDFPFQCYGSPEMK
GYKFTFTPTSRFGAKTPPQLGKLCHGVDLRGLDPEQVIAGGINLDYVIDAYNNLHRQGKP
FLLKEGERNFFNLLMGNTQVYDMIVAGKSAKHIKATWQKDIEKFKAQRKPYLLYKE

Enzyme Prediction     

No EC number prediction in MGYG000003590_01818.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH171	65	414	7.1e-113	0.9971830985915493

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07075	DUF1343	7.05e-170	66	414	1	362	Protein of unknown function (DUF1343). This family consists of several hypothetical bacterial proteins of around 400 residues in length. The function of this family is unknown.
COG3876	YbbC	5.60e-92	55	414	36	409	Uncharacterized conserved protein YbbC, DUF1343 family [Function unknown].
cd05243	SDR_a5	0.002	72	244	8	178	atypical (a) SDRs, subgroup 5. This subgroup contains atypical SDRs, some of which are identified as putative NAD(P)-dependent epimerases, one as a putative NAD-dependent epimerase/dehydratase. Atypical SDRs are distinct from classical SDRs. Members of this subgroup have a glycine-rich NAD(P)-binding motif that is very similar to the extended SDRs, GXXGXXG, and binds NADP. Generally, this subgroup has poor conservation of the active site tetrad; however, individual sequences do contain matches to the YXXXK active site motif, the upstream Ser, and there is a highly conserved Asp in place of the usual active site Asn throughout the subgroup. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), progesterone 5-beta-reductase like proteins, phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUU00717.1	6.45e-174	45	416	55	420
AVM58209.1	8.44e-174	45	416	23	388
QMI79524.1	8.44e-174	45	416	23	388
QBJ18079.1	1.20e-173	45	416	23	388
QPH58384.1	1.20e-173	45	416	23	388

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4JJA_A	8.35e-164	42	416	2	370	Crystalstructure of a DUF1343 family protein (BF0379) from Bacteroides fragilis NCTC 9343 at 1.30 A resolution [Bacteroides fragilis NCTC 9343]
4K05_A	4.01e-43	60	415	28	399	Crystalstructure of a DUF1343 family protein (BF0371) from Bacteroides fragilis NCTC 9343 at 1.65 A resolution [Bacteroides fragilis NCTC 9343],4K05_B Crystal structure of a DUF1343 family protein (BF0371) from Bacteroides fragilis NCTC 9343 at 1.65 A resolution [Bacteroides fragilis NCTC 9343]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40407	6.39e-70	55	414	47	414	Uncharacterized protein YbbC OS=Bacillus subtilis (strain 168) OX=224308 GN=ybbC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000001	0.000455	0.999600	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003590_01818.