CAZyme Information: MGYG000003593_00172

Basic Information

• Species: Enterocloster sp900770345
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Enterocloster; Enterocloster sp900770345
• CAZyme ID: MGYG000003593_00172
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
482	MGYG000003593_35|CGC1	55929.1	5.2519

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003593	4467273	MAG	Fiji	Oceania

• Gene Location: Start: 2080; End: 3528 Strand: -

Full Sequence      

MSFPENFLWGGATANAQYEGAFNEGGRGLSQIDFCECVGKDKGTTEFSHELTYERYLHNK
EHQDEMNLPFRRGTDFYHRYKEDIALMAEMGAKTFRLSISWCRIFPTGEEEKPNQEGLDF
YHNVFRELRKYHIEPLVTMIHYEVPDALVEKYNGWESPKLVDLFVKYGKTLIDEYKDEVK
YWITFNEINWTVVTPYSAAGVFTSRSRKNRLSAMHQALHHQLVASALLVKYCHKVSPSAK
IGLMIGKFMIYPMTCKPEDAANAYKESRLNTLYFDVAVRGAYPKWLYKYYQDYDIDIDWY
PDYEKILAGDSIDYIAIAYYSSNVVDASIDSAMEKDNLLVSPPNPYLKRTSWGSQIDPLG
LTISLEQLYDQYQKPLFVVENGIGAFDMLTDDHKVHDPYRIEFHREHIKAMQKAIDDGVE
LWGYTTWGIVDLVSASGGQMCKRYGFVYVDADDDGNGTYNRYPKDSFYWYKKCIATRGED
LD

Enzyme Prediction     

No EC number prediction in MGYG000003593_00172.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	2	478	7.5e-137	0.9883449883449883

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09852	PRK09852	0.0	2	482	3	474	cryptic 6-phospho-beta-glucosidase; Provisional
COG2723	BglB	5.53e-178	1	482	2	458	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	1.80e-172	1	482	4	478	6-phospho-beta-glucosidase; Reviewed
PRK09589	celA	5.85e-168	1	481	2	476	6-phospho-beta-glucosidase; Reviewed
PRK15014	PRK15014	1.95e-148	1	481	4	477	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBK63065.1	2.20e-197	1	481	1	481
QNM13367.1	1.73e-196	1	482	1	482
QTZ57784.1	3.94e-190	1	481	1	479
AGS46819.1	3.94e-190	1	481	1	479
VTS96688.1	3.47e-186	1	481	1	479

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	2.59e-164	3	481	8	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
4IPL_A	8.67e-144	3	481	20	485	Thecrystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPL_B The crystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_B The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_E The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4]
4F66_A	3.60e-141	4	481	8	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	1.02e-140	4	481	8	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
2XHY_A	1.28e-138	1	481	6	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40740	1.75e-164	3	481	8	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
Q46130	5.31e-162	1	482	5	472	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
P24240	1.09e-156	3	482	4	474	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
Q48409	2.42e-145	2	481	3	462	Phospho-cellobiase OS=Klebsiella oxytoca OX=571 GN=casB PE=3 SV=1
P26206	6.01e-141	3	481	5	463	6-phospho-beta-glucosidase OS=Dickeya chrysanthemi OX=556 GN=arbB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003593_00172.