CAZyme Information: MGYG000003593_00905

Basic Information

• Species: Enterocloster sp900770345
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Enterocloster; Enterocloster sp900770345
• CAZyme ID: MGYG000003593_00905
• CAZy Family: GH0
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
416	MGYG000003593_102|CGC1	46144.71	4.3035

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003593	4467273	MAG	Fiji	Oceania

• Gene Location: Start: 19136; End: 20386 Strand: -

Full Sequence      

MATSPERTSSGMLQIHVVNIQNNFPIQNANVTISYTGDPESPIEQLHTNSSGQTETISLP
APPVEYSLEPGILQPYSEYNVLIEAEGFRPLAVSGTEILAGTTALQPAAMTPENGEKAPE
NPVVIPEHTLYGNFPPKIPEAEIKPVNESGEIVLSRVVVPQTIVVHDGVPTDSTAPDYYV
PYRDYIKNVASSEIYSTWPRASITANVLAIMSFTLNRVYTEWYRNKGYDFTITSSTAFDH
KWIYGRNIFESISQVVDEIFDSYLSRPGVRQPILTQYCDGRQVQCPDWMTQWGSCSLGEQ
GYSPIEILRYFYGDSIYINTAEQISGIPASWPGSDLTLGSSGDKVRQLQEQLDTIATVYT
AIPRVTPDGIYGQRTADAVQEFQSIFGLPQTGVVDFATWYRISHIYVGITRIAELV

Enzyme Prediction     

No EC number prediction in MGYG000003593_00905.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01471	PG_binding_1	1.47e-13	341	402	1	57	Putative peptidoglycan binding domain. This domain is composed of three alpha helices. This domain is found at the N or C-terminus of a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. This family is found N-terminal to the catalytic domain of matrixins. The domain is found to bind peptidoglycan experimentally.
COG3409	PGRP	4.39e-08	336	402	39	102	Peptidoglycan-binding (PGRP) domain of peptidoglycan hydrolases [Cell wall/membrane/envelope biogenesis].
COG3409	PGRP	2.32e-06	332	404	117	185	Peptidoglycan-binding (PGRP) domain of peptidoglycan hydrolases [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANU48790.1	8.05e-279	1	416	1	416
QQR02302.1	8.05e-279	1	416	1	416
QIX92999.1	3.28e-278	1	416	1	416
ASN94441.1	5.19e-275	1	416	1	416
QRP40879.1	5.19e-275	1	416	1	416

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000014	0.000035	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003593_00905.