CAZyme Information: MGYG000003594_02097

Basic Information

• Species: RUG12045 sp900770325
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; RUG12045; RUG12045 sp900770325
• CAZyme ID: MGYG000003594_02097
• CAZy Family: GT2
• CAZyme Description: Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
330		37894.35	9.2138

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003594	2830222	MAG	Fiji	Oceania

• Gene Location: Start: 5575; End: 6567 Strand: -

Full Sequence      

MLHSIIIPCYKSDQTIRKVVELTMAEMEKMGRNQYEFVLVDDYSPDGGKTLKVLRELVQD
YDCVKVVELAKNSGQHNAIMAGLNYASGDILIAMDDDMQTHPSQLPIILNELDKGYDIVY
GYYPHKQHSKFRNFGSYINYMTVRILLKKPKDLKTSSFWAIKKFVRDYAVEYKSAYTHLQ
GVFLRITRNISSVPIQHFKREVGTSNYTMKKLMQLWSNIMGFSIVPLRLATILGYIFSVT
GILGAVAVIIRKIVRPVTYIGWPSMMVCICFFSGLILLFMGLIGEYIGRIFLNISNNPQF
VVRQIDEHGHVPFVLDEEGNRFEKVDTDKK

Enzyme Prediction     

No EC number prediction in MGYG000003594_02097.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	4	156	9.2e-27	0.888235294117647

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04187	DPM1_like_bac	9.44e-45	5	183	1	176	Bacterial DPM1_like enzymes are related to eukaryotic DPM1. A family of bacterial enzymes related to eukaryotic DPM1; Although the mechanism of eukaryotic enzyme is well studied, the mechanism of the bacterial enzymes is not well understood. The eukaryotic DPM1 is the catalytic subunit of eukaryotic Dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. The enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. This protein family belongs to Glycosyltransferase 2 superfamily.
PRK10714	PRK10714	9.74e-42	4	318	9	324	undecaprenyl phosphate 4-deoxy-4-formamido-L-arabinose transferase; Provisional
cd04179	DPM_DPG-synthase_like	3.50e-40	5	167	1	164	DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily. DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. The UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate. This protein family belongs to Glycosyltransferase 2 superfamily.
pfam00535	Glycos_transf_2	6.92e-22	4	121	1	113	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd06442	DPM1_like	5.49e-21	5	210	1	212	DPM1_like represents putative enzymes similar to eukaryotic DPM1. Proteins similar to eukaryotic DPM1, including enzymes from bacteria and archaea; DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. This protein family belongs to Glycosyltransferase 2 superfamily.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUF80541.1	1.81e-162	1	312	1	312
SOB73627.1	1.54e-161	1	305	1	305
QSI24324.1	1.61e-115	2	305	18	322
QNM10258.1	5.33e-89	1	304	1	302
VEH00837.1	1.83e-87	4	305	5	303

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EKE_A	5.76e-29	4	305	29	329	Structureof the polyisoprenyl-phosphate glycosyltransferase GtrB (F215A mutant) [Synechocystis sp. PCC 6803 substr. Kazusa],5EKE_B Structure of the polyisoprenyl-phosphate glycosyltransferase GtrB (F215A mutant) [Synechocystis sp. PCC 6803 substr. Kazusa],5EKE_C Structure of the polyisoprenyl-phosphate glycosyltransferase GtrB (F215A mutant) [Synechocystis sp. PCC 6803 substr. Kazusa],5EKE_D Structure of the polyisoprenyl-phosphate glycosyltransferase GtrB (F215A mutant) [Synechocystis sp. PCC 6803 substr. Kazusa]
5EKP_A	5.76e-29	4	305	29	329	Structureof the polyisoprenyl-phosphate glycosyltransferase GtrB (WT) [Synechocystis sp. PCC 6803 substr. Kazusa],5EKP_B Structure of the polyisoprenyl-phosphate glycosyltransferase GtrB (WT) [Synechocystis sp. PCC 6803 substr. Kazusa],5EKP_C Structure of the polyisoprenyl-phosphate glycosyltransferase GtrB (WT) [Synechocystis sp. PCC 6803 substr. Kazusa],5EKP_D Structure of the polyisoprenyl-phosphate glycosyltransferase GtrB (WT) [Synechocystis sp. PCC 6803 substr. Kazusa]
5MLZ_A	7.89e-14	4	165	26	188	Dolichylphosphate mannose synthase in complex with GDP and Mg2+ [Pyrococcus furiosus DSM 3638],5MM0_A Dolichyl phosphate mannose synthase in complex with GDP-mannose and Mn2+ (donor complex) [Pyrococcus furiosus DSM 3638],5MM1_A Dolichyl phosphate mannose synthase in complex with GDP and dolichyl phosphate mannose [Pyrococcus furiosus DSM 3638]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B7LM77	5.24e-38	4	305	11	313	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73) OX=585054 GN=arnC PE=3 SV=1
A1ADA6	1.31e-37	4	305	11	313	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Escherichia coli O1:K1 / APEC OX=405955 GN=arnC PE=3 SV=1
Q0TFI8	1.31e-37	4	305	11	313	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) OX=362663 GN=arnC PE=3 SV=1
Q1R9G1	1.31e-37	4	305	11	313	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Escherichia coli (strain UTI89 / UPEC) OX=364106 GN=arnC PE=3 SV=1
Q8FFM2	1.31e-37	4	305	11	313	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=arnC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
228	250
262	284