CAZyme Information: MGYG000003595_00705

Basic Information

• Species: HGM11525 sp900770405
• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales_A; UBA1381; HGM11525; HGM11525 sp900770405
• CAZyme ID: MGYG000003595_00705
• CAZy Family: PL21
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
991	MGYG000003595_127|CGC1	109986.57	5.0556

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003595	2475226	MAG	Fiji	Oceania

• Gene Location: Start: 6698; End: 9673 Strand: +

Full Sequence      

MRYKDEEIPWDAPQIKPIAGHPRLFLTREQLAQLRKNMEYAELAPQVAAYRKCAAEPILP
HGVHSPLYEMRLEFRALAYLLGDIDRAGAERTVKCALEYLSAVEFDPKAADITRAIGETM
TCGAVVYDWCYDVISAEDKSAFIARFKELAAQKEIGYPPTNPNLSSIASHAGEYEIFRDM
IGVGVAVYDEDSEMYDLAAGRFFAQMAEPRRYFNKSGNHPMGSSYGYFRFGCELWAQIIF
ARMGYADVLGGDMARVAYKWLFERLPFGQRFKDGDDFEYSKNRLEAYPTNDVRELMMAAN
FFADPYLRRQSLAALSLRNYEPEKFWTLIFSEPGVGIKEPDTLPLARKTTYPLTSLVART
GWQTGKDAPTAMAQMKIQEKFIACHMHLDSGGFQIYYKGNLATASGIYQGMDGGSGCAHY
ANYYTRTVAHNCVTVTDLHETMLYSHGADTDFSNDGGQRRGMTAPFAVFFKEQVVEDKRA
AACGIYAGPNPQTPKFSYVAGDIHFGYGEKVEKYRRSMVFADLFDEEFPAAFVVYDRVCA
SNAQFKKRWLLHSIEEPEIDADRVTVSRTEAGFGGKLVDTVLLPEDFRIEKIGGAGREYT
VGGENFPNRDYAGARTEGAAWRVELSPSAARKEDVFLNAMYVTDASNTRRLEMTRVRTGG
FVGAAVRDRLIMFAESDEAACGAFCAEVPDGGFETVSVLLAGIAPGVWSINGEFFAEVKP
EEGVLYFEGKPGRYEIAPTPGKMPTAREYAAAQKSKIGDFTVYFGGQFLNQPKPAKLIDG
VPYLPAAEFAAYFGAAVKTDGAAVEITNAAGERLSVRGGYASLPSQHMPREVGGAVYICF
ADLEEFFGMVCEYDAAARLFKAVRVDAEFRKLVKNEKIFAPTDVIAGACDENLPRFAAEY
TTETHWAADGGDDAWLTYDLGDETEFSRLLLGASADFEVELSLDGRNYRHIYCGAAAGKM
QIYALGRQRARFVRVCIAGDRVAVTVMAVME

Enzyme Prediction     

No EC number prediction in MGYG000003595_00705.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL21	372	437	5.7e-22	0.9027777777777778

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam18675	HepII_C	4.16e-09	655	736	1	86	Heparinase II C-terminal domain. Heparinase II (HepII) is an 85-kDa dimeric enzyme that depolymerizes both heparin and heparan sulfate glycosaminoglycans. The protein is composed of three domains: an N-terminal alpha-helical domain, a central two-layered beta-sheet domain, and a C-terminal domain forming a two-layered beta-sheet. The C-terminal domain contains nine beta-strands packed together in a manner resembling a beta-barrel.
pfam00754	F5_F8_type_C	3.43e-07	904	975	24	110	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
pfam07833	Cu_amine_oxidN1	9.62e-05	756	807	41	92	Copper amine oxidase N-terminal domain. Copper amine oxidases catalyze the oxidative deamination of primary amines to the corresponding aldehydes, while reducing molecular oxygen to hydrogen peroxide. These enzymes are dimers of identical subunits, each comprising four domains. The N-terminal domain, which is absent in some amine oxidases, consists of a five-stranded antiparallel beta sheet twisted around an alpha helix. The D1 domains from the two subunits comprise the 'stalk' of the mushroom-shaped dimer, and interact with each other but do not pack tightly against each other.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBH20141.1	2.76e-142	7	981	225	1209
ACU04612.1	3.50e-134	17	736	44	770
ABJ17170.1	6.88e-134	17	736	44	770
AAB18277.1	6.88e-134	17	736	44	770
ACW20418.1	6.88e-134	17	736	44	770

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2FUQ_A	6.39e-136	17	736	19	745	ChainA, heparinase II protein [Pedobacter heparinus],2FUQ_B Chain B, heparinase II protein [Pedobacter heparinus]
3E80_A	6.76e-136	17	736	21	747	Structureof Heparinase II complexed with heparan sulfate degradation disaccharide product [Pedobacter heparinus],3E80_B Structure of Heparinase II complexed with heparan sulfate degradation disaccharide product [Pedobacter heparinus],3E80_C Structure of Heparinase II complexed with heparan sulfate degradation disaccharide product [Pedobacter heparinus]
3E7J_A	4.13e-133	17	736	21	747	ChainA, Heparinase II protein [Pedobacter heparinus],3E7J_B Chain B, Heparinase II protein [Pedobacter heparinus]
2FUT_A	9.36e-130	17	736	20	746	ChainA, heparinase II protein [Pedobacter heparinus],2FUT_B Chain B, heparinase II protein [Pedobacter heparinus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
C6XZB6	7.00e-135	17	736	44	770	Heparin and heparin-sulfate lyase OS=Pedobacter heparinus (strain ATCC 13125 / DSM 2366 / CIP 104194 / JCM 7457 / NBRC 12017 / NCIMB 9290 / NRRL B-14731 / HIM 762-3) OX=485917 GN=hepB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003595_00705.