CAZyme Information: MGYG000003595_01782

Basic Information

• Species: HGM11525 sp900770405
• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales_A; UBA1381; HGM11525; HGM11525 sp900770405
• CAZyme ID: MGYG000003595_01782
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
729		81896.42	4.7543

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003595	2475226	MAG	Fiji	Oceania

• Gene Location: Start: 2025; End: 4214 Strand: +

Full Sequence      

MNKQFITMSGARCTFDNYVAAPYIRKSFTLDFVPEMAEISVCGLGFYRLFINGSEITKGQ
LAPYINNPDHFCYFDRYDLSGRLAEGENVVGIVLGNGFYNPFGAAEWGFEKAPWVGTPCV
ALELTAEGGSKSLHLTADESFRVHPSPIIFDELRMGEYYDANAEIDGWCMPGFDDSGWEN
AIFAPIPRGEMRECTAEPIIAKREIAAKSITKTDGGYLYDFGENTAGVCRLRISARKNQK
IELRHCEILKDGKFSDENIIFDHDYYRTHNQKDIYIAKGVGCEEYTPGFTYHGFRYVQVA
GIDETQATAELLTCVVMHSDIAEIGGFECSDEVANTLFDMVKRSDLSNFYYFPTDCPHRE
KHGWTGDAAASAEHMALMYDVEKSWREWLANIRMSQNSRGELPGIVPTAGWGYEWGNGPA
WDRVLFDLPYELFKKRANTDVIRENAHAMLRYLQYITGRRSSDGTVAFGLGDWVPVGRRP
DAYTAPLALTDSIMVMDMARKATEMFAAAELSHEADYARAVAEDMRCAIRRNLVDFDSMT
AAGECQSSQAMALFYGVFDADEERRAFEVLLSLIHENGDSFDCGYLGLRVIFHVLARFGE
TELAYKMITKKDYPSYGHLLELGETTLTEQFMPDGVSCGSHNHHFLGDIANWFMSELAGL
KIIDNAHVRIEPAFIGGIDRASAYYELPQGRVSVSWERADSEIVLRIDAPQGCDVTIPAW
VTKSARIKF

Enzyme Prediction     

No EC number prediction in MGYG000003595_01782.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	212	717	3e-124	0.9880952380952381
CBM67	17	181	2.8e-27	0.8693181818181818

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	3.37e-70	322	653	1	336	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	3.84e-38	37	199	6	168	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	2.96e-22	210	318	1	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	6.16e-06	667	718	11	64	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGQ94103.1	5.85e-132	10	717	132	838
ANH83620.1	7.07e-131	21	725	140	850
QGA24212.1	2.90e-129	18	717	153	858
QDH80958.1	1.81e-127	21	701	153	836
AVM44981.1	3.02e-127	21	719	50	751

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	6.54e-96	21	710	176	889	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
6GSZ_A	8.82e-76	25	696	135	816	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
3W5M_A	3.40e-71	20	721	301	994	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	4.37e-76	20	710	183	897	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
P9WF03	5.72e-72	23	710	172	869	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
Q82PP4	1.66e-70	20	721	301	994	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	2.54e-69	16	727	168	888	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003595_01782.