CAZyme Information: MGYG000003596_00379

Basic Information

• Species: UMGS2070 sp900557655
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; UBA1242; UMGS2070; UMGS2070 sp900557655
• CAZyme ID: MGYG000003596_00379
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
356		38142.75	10.7269

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003596	879465	MAG	Fiji	Oceania

• Gene Location: Start: 118705; End: 119775 Strand: -

Full Sequence      

MKSSIVLTGGGTAGHVTGNLALYPTLKKHFLNIYYIGSNNSIEEKLIKSKTQATFYGISA
VKLVRGKILVNLALPFKLLRAVKQAKKILKKLRPNVVFSKGGFVSVPVILAAKSLKIPIV
CHESDLSMGLANKIGSRYATTVCTTFEKTAKPFKNKGIFTGSPLQKEFENLPTQAAAKHK
LHLPADKKVLLVTGGSLGAAAINSAVRESLDALTKSFYVVHVTGKGNANAIKNAYYRQIE
FASNMPELIAAADVVISRAGSNTIFELAFANKPMLLIPLPKGASRGDQIENAEYFKQCGY
AHVLSQQALTRASLISAVNETLKNAPSLKNALKKSGLKNGTALIAKTIFSASDGKK

Enzyme Prediction     

No EC number prediction in MGYG000003596_00379.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	190	333	1.7e-43	0.9235668789808917

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00726	murG	8.17e-131	5	348	4	351	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
cd03785	GT28_MurG	7.23e-106	4	346	1	349	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0707	MurG	2.29e-105	5	348	3	351	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
PRK12446	PRK12446	5.02e-102	4	348	3	349	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed
TIGR01133	murG	9.65e-92	3	348	1	348	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AST92532.1	3.99e-96	2	348	3	351
ACD52855.1	2.41e-95	2	351	3	354
AJF28779.1	2.41e-95	2	351	3	354
AJF31840.1	2.41e-95	2	351	3	354
AYA98615.1	4.00e-95	5	348	4	348

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3S2U_A	8.23e-36	1	330	1	330	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]
7D1I_A	4.29e-35	5	335	12	346	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]
1F0K_A	1.12e-32	5	322	9	319	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]
6PNT_A	9.55e-06	188	339	271	422	StructuralCharacterization of UDP-glycosyltransferase from Tetranychus Urticae [Tetranychus urticae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B2V1X5	4.83e-96	2	351	3	354	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Clostridium botulinum (strain Alaska E43 / Type E3) OX=508767 GN=murG PE=3 SV=1
B2TLE0	1.37e-92	2	351	3	354	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Clostridium botulinum (strain Eklund 17B / Type B) OX=935198 GN=murG PE=3 SV=1
A6M1F0	1.66e-91	2	356	3	359	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) OX=290402 GN=murG PE=3 SV=1
Q0SRB4	6.25e-91	2	340	3	343	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Clostridium perfringens (strain SM101 / Type A) OX=289380 GN=murG PE=3 SV=1
Q0TNP7	6.25e-91	2	340	3	343	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=murG PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000038	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003596_00379.