CAZyme Information: MGYG000003599_00072

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes
• CAZyme ID: MGYG000003599_00072
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
375		42264.15	7.3235

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003599	1382007	MAG	Fiji	Oceania

• Gene Location: Start: 846; End: 1973 Strand: -

Full Sequence      

MKYYIIAGEPSGDLHGSNLMKGLLKSDPEAKFRFCGGDMMSAVGGRENLLKHYREMSFFG
FVQVAMNIRTILGQMGECCRDIMAFQPDVVILIDYPGFNIKIAEFAHNNGIPVHYYIAPK
VWAWKERRVKALKKWVDKLYTIFPFETPYFRSKGIEPHFCGNPLVDAISERCAAAPVEEE
FRKQNGLDERPIIALLAGSRVSEIKANLRFMAQIAERIPTHQFVVAGVGWISREQYEQYT
ANLDVKFVCDKTYELLQISEAAVVTSGTATLETALIGIPEVVVYGIPWLYEKVKPYLLKI
PFVSLVNINMGREVVREMVVYKPSVAEAEQELRSIMEGGAKREKMLADFDELRAIIGGAG
ASDRFAADIVRTIQK

Enzyme Prediction     

No EC number prediction in MGYG000003599_00072.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	355	5.7e-103	0.9858757062146892

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	7.30e-98	1	370	2	371	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.04e-89	1	375	2	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	7.09e-68	4	344	2	347	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	7.96e-60	5	370	10	383	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	1.82e-42	1	357	2	333	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFL77950.1	6.08e-173	1	374	1	374
BBL00808.1	2.33e-170	1	374	1	374
BBL11605.1	1.90e-169	1	374	1	374
BBL08813.1	1.90e-169	1	374	1	374
BBL04027.1	2.42e-159	1	375	1	375

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	4.44e-33	5	352	11	361	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	6.15e-33	5	352	11	361	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2LVL8	7.21e-65	5	375	8	380	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q39T49	8.90e-63	5	375	11	382	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
Q1D393	1.87e-61	5	373	9	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q74AT9	5.36e-61	5	375	11	382	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
B4UHR6	3.68e-57	5	374	13	383	Lipid-A-disaccharide synthase OS=Anaeromyxobacter sp. (strain K) OX=447217 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000032	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003599_00072.