CAZyme Information: MGYG000003599_00363

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes
• CAZyme ID: MGYG000003599_00363
• CAZy Family: GH127
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
679		76288.73	7.4553

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003599	1382007	MAG	Fiji	Oceania

• Gene Location: Start: 60; End: 2099 Strand: -

Full Sequence      

MKKLFFTLLASAMCASAVAQNSSIEFVATPDTASKSVNYNSNRAPLAPAAFIKLPLGAIT
PEGWVGEMLKRQGDGLAGHLGEISAWLNKKGNAWLEKEGHAGWEEVPYWLRGYSDMSFIL
KDEKMKAETMVWIEAILASQRPDGWFGPMITNKNTGNDYWPNMIVLFTLQNYYEATGDKR
VIDFMTKYFKYELAQPDGKIIASYWENMRGGDNLYSVYWLYNITGDAWLLDLATKLDRCT
ANWKMGNTLPNWHVVNIAQGFREPATYAMQSKNPAHTEATYFNFKHVRDLYGQVPGGMYG
ADENARKGYDDPRQGAETCSFAEQMTSDGILTRITGDVFWADNCEDVMFNSFPAAFTPDM
KSLRYITSPNMVLADGRNHHPGIDNAGPFLMMNPFSSRCCQHNHTHGLPYYIGNMVMATN
DNGLMTNLYGSATVNAKVGKKVGVTLKMESNYPFEETIRLSVDPAKSVTFPLYMRVPAWC
DNASVKINGTESFTASSNNGYIKISRKWQKGDKVELVLPMKLWMREWKKNKNSVSVNYGP
LTFSLLIKENYIKKSSKETAIGDSRWQEGADAEAWPSWEIHPGSNWNYGLVYDPAKSLES
QFTVEKRAYPADNNPFTNDNAPIQLKTKGRQIPAWGLDQHWLCGILPESPVTSTQPVTDL
TLVPMGGARLRISAFPVIR

Enzyme Prediction     

No EC number prediction in MGYG000003599_00363.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	310	543	1.3e-36	0.4389312977099237

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	1.83e-101	31	544	11	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	3.15e-30	133	541	95	498	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QXQ95199.1	2.54e-172	28	676	29	665
AWL89945.1	1.47e-171	28	676	29	665
BCJ47054.1	2.06e-171	28	678	19	647
BAG23430.1	1.59e-170	33	678	38	667
ALU92252.1	2.32e-170	28	676	29	665

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MQO_A	6.16e-21	317	545	381	608	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
4QJY_A	1.70e-20	105	545	78	561	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	1.60e-19	105	545	78	561	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
6YQH_AAA	1.57e-13	314	544	334	560	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
6EX6_A	5.36e-13	110	520	91	517	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001717	0.752823	0.244186	0.000638	0.000329	0.000274

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003599_00363.