CAZyme Information: MGYG000003599_00662

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes
• CAZyme ID: MGYG000003599_00662
• CAZy Family: GH0
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
443		50663.1	6.7048

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003599	1382007	MAG	Fiji	Oceania

• Gene Location: Start: 3; End: 1334 Strand: +

Full Sequence      

MCSSDLDLIPHGKVVGKSVKSPRMTVGWFSDWREGMELFGDQCATFAPKLPSLGARPFGW
NSWGALATKVTFQKSVEVSDFIHDHLQSHSFENEGTVYIDIDSFWDFGFRHDQHKIFVEH
CHKNGQKAGIYWCPFTDWGGNAKGRVVRDMDYRWEDVYIRAKGEPVRFDGGLAIDPTHPA
VRRRIELQIKQFLEWGYEYVKLDFMAHGAYQSDSYYDKSVTTAMQAYNQGMQYIVEQCEG
KMWINLSIAPLFPGNYAHSRRISCDAWADIKNTEYVLNSLTYGWWLDHIYHYNDGDHIVY
KDVSEGENRARVTSSAITGIYFLGDDMSKGGSPEVKAKVVRSTTNPGINEIARTCPSFRP
VEVARGDRGSDMFYHATEKYLYVAIFNYSPRRVVKHLELQRLGLSADKSYNAVELWSGDK
AEFKGEIAATIPAKDVVVYRIEF

Enzyme Prediction     

No EC number prediction in MGYG000003599_00662.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	7.18e-16	55	329	1	281	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
cd14792	GH27	2.70e-13	57	296	2	214	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
pfam17801	Melibiase_C	2.88e-09	382	441	17	74	Alpha galactosidase C-terminal beta sandwich domain. This domain is found at the C-terminus of alpha galactosidase enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJR69930.1	4.07e-140	7	442	241	674
AII65845.1	4.07e-140	7	442	241	674
QJR74262.1	4.07e-140	7	442	241	674
QJR78498.1	4.07e-140	7	442	241	674
QJR65668.1	4.07e-140	7	442	241	674

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999965	0.000043	0.000006	0.000000	0.000000	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003599_00662.