CAZyme Information: MGYG000003600_00959

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae
• CAZyme ID: MGYG000003600_00959
• CAZy Family: GH1
• CAZyme Description: Beta-glucosidase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
428		49429.85	6.6329

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003600	1529489	MAG	Fiji	Oceania

• Gene Location: Start: 2593; End: 3879 Strand: -

Full Sequence      

MEFRLPKGMLLGVSSAAAQVEGGEVNSNWNDWYHKGRIKDGSNPAESDHWERWQEDTELM
ASMGVQICRFGIEWARLIPEPGKPDEATIARYREELSAMLAHGIRPLLTIHHFANPMWFE
SKGGFTKRENLNDFLELVQLVANRFGDLVSEYITINEPNVYALNGYGWGDWPPGEKNFIK
LFKVLENMAWCHIKAYGILHTTRARMGFTDTKVGFANHLRVFDPKNAKNPWHCLGSRITE
WAFQGAVTRAMTLGEFKFPLRNWDKLPRGEYADFNGVNYYTRSTVSGIGDGVRENSPRND
LDWEIYPDGLIRCGTMLQKVLDRPLWVTENGTCDNDDRFRARYICEHLKAMADSGLPFER
YYHWCFCDNFEWIEGNRARFGVVHVDYENKRNRTVKESGRFFSAVIAAGGVTQEIFEQYV
KGKEYDVR

Enzyme Prediction     

No EC number prediction in MGYG000003600_00959.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	2	408	3.6e-100	0.9883449883449883

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2723	BglB	3.16e-90	4	416	3	460	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
pfam00232	Glyco_hydro_1	2.32e-76	1	410	1	452	Glycosyl hydrolase family 1.
PLN02998	PLN02998	7.42e-35	5	406	31	485	beta-glucosidase
PLN02849	PLN02849	4.42e-30	6	406	31	480	beta-glucosidase
PLN02814	PLN02814	3.02e-25	5	403	28	477	beta-glucosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABX42305.1	1.80e-190	1	425	1	425
QSI05112.1	5.89e-150	3	428	2	427
QOW59739.1	3.37e-149	3	428	2	427
AGT44419.1	9.60e-149	3	428	2	427
AAS12396.1	3.14e-147	3	428	2	427

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1VFF_A	4.37e-77	1	419	1	416	beta-glycosidasefrom Pyrococcus horikoshii [Pyrococcus horikoshii]
6YN7_A	7.36e-68	6	408	9	445	ChainA, AHE, beta-glucosidase enzyme [Alicyclobacillus herbarius],6YN7_B Chain B, AHE, beta-glucosidase enzyme [Alicyclobacillus herbarius],6YN7_C Chain C, AHE, beta-glucosidase enzyme [Alicyclobacillus herbarius],6YN7_D Chain D, AHE, beta-glucosidase enzyme [Alicyclobacillus herbarius]
6Z1H_A	5.15e-66	4	414	10	453	ChainA, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1H_B Chain B, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1M_A Chain A, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_B Chain B, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_C Chain C, Ancestral reconstructed glycosidase [synthetic construct]
2O9R_A	2.19e-61	3	410	10	451	ChainA, Beta-glucosidase B [Paenibacillus polymyxa]
2O9P_A	2.30e-61	3	410	12	453	ChainA, Beta-glucosidase B [Paenibacillus polymyxa],2O9T_A Chain A, Beta-glucosidase B [Paenibacillus polymyxa],2Z1S_A Chain A, Beta-glucosidase B [Paenibacillus polymyxa]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P22505	1.63e-59	3	410	6	447	Beta-glucosidase B OS=Paenibacillus polymyxa OX=1406 GN=bglB PE=1 SV=1
B9K7M5	2.20e-58	4	412	3	443	1,4-beta-D-glucan glucohydrolase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E) OX=309803 GN=gghA PE=1 SV=2
Q08638	2.31e-58	4	411	5	444	Beta-glucosidase A OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=bglA PE=1 SV=1
P0C946	2.58e-53	4	391	3	423	1,4-beta-D-glucan glucohydrolase (Fragment) OS=Thermotoga neapolitana OX=2337 GN=bglA PE=3 SV=1
Q03506	1.32e-50	6	409	7	446	Beta-glucosidase OS=Niallia circulans OX=1397 GN=bglA PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.915946	0.083411	0.000269	0.000174	0.000097	0.000125

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003600_00959.