CAZyme Information: MGYG000003601_00840

Basic Information

• Species: HGM12713 sp900770605
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-272; HGM12713; HGM12713 sp900770605
• CAZyme ID: MGYG000003601_00840
• CAZy Family: GH53
• CAZyme Description: Arabinogalactan endo-beta-1,4-galactanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
447	MGYG000003601_95|CGC1	48582.43	4.4084

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003601	1391946	MAG	Fiji	Oceania

• Gene Location: Start: 1177; End: 2520 Strand: -

Full Sequence      

MKNIFGKVLCALVILALGLSAFTSCSAEQDVSAEGGPKINTDWRPNAINTNVSSDTLRVQ
KVEGLSEDFIMGMDASCVPALEACGVKYYDFDGNEKDVFQILSENGINYIRVRVWNDPFD
ANGNGYGGGNCDIDNAVAIGQRATRYGMKLLVDFHYSDFWADPAKQMCPKAWVGMSIDEK
SDALYKYTVECLEKLVAAGVDVGMVQVGNETNGALCGEKSSSLGGWKNITRLLSAGSAAV
REICPNALVAVHFANPEKLGTYETYGKNLDYYGVDYDVFASSYYPFWHGTLENLEGVLSD
IVNKYGKKVMVAETSYAYTPVDTDHFGNTIGEGDGIVRSYPYTVQGQADLVSDVIRTVAG
IESGIGVFYWEGTWISVGGGSYEKNLELWEKHGAGWATSYAGEYDPNDAGKWYGGCAVDN
QAMFRAGGRPIESLKVFALVRDGNIPN

Enzyme Prediction     

EC	3.2.1.89

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH53	70	437	8.1e-128	0.9970760233918129

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3867	GanB	9.99e-148	51	446	21	400	Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism].
pfam07745	Glyco_hydro_53	1.31e-135	70	437	1	333	Glycosyl hydrolase family 53. This domain belongs to family 53 of the glycosyl hydrolase classification. These enzymes are enzymes are endo-1,4- beta-galactanases (EC:3.2.1.89). The structure of this domain is known and has a TIM barrel fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUC66973.1	2.65e-180	53	444	27	418
QTE72378.1	4.29e-179	53	444	27	418
QTE73367.1	4.29e-179	53	444	27	418
QTE69470.1	6.95e-178	57	444	31	418
QUA52781.1	1.13e-176	54	444	28	418

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1R8L_A	2.65e-160	49	443	4	394	Thestructure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1R8L_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1UR0_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR0_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],2CCR_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2CCR_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis]
2GFT_A	2.15e-159	49	443	4	394	ChainA, Glycosyl Hydrolase Family 53 [Bacillus licheniformis],2GFT_B Chain B, Glycosyl Hydrolase Family 53 [Bacillus licheniformis]
7OSK_A	1.13e-88	55	442	36	396	ChainA, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230],7OSK_B Chain B, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230]
1HJQ_A	1.39e-49	72	375	6	301	Structureof two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Humicola insolens]
1HJS_A	1.09e-47	72	375	6	301	Structureof two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_A Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q65CX5	1.72e-159	47	443	27	419	Endo-beta-1,4-galactanase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46) OX=279010 GN=ganB PE=1 SV=1
O07013	8.23e-154	50	446	34	426	Endo-beta-1,4-galactanase OS=Bacillus subtilis (strain 168) OX=224308 GN=ganB PE=1 SV=1
P48843	9.39e-60	67	393	4	337	Uncharacterized protein in bgaB 5'region (Fragment) OS=Niallia circulans OX=1397 PE=3 SV=1
P83691	7.60e-49	72	375	6	301	Arabinogalactan endo-beta-1,4-galactanase OS=Humicola insolens OX=34413 PE=1 SV=1
P83692	5.95e-47	72	375	6	301	Arabinogalactan endo-beta-1,4-galactanase OS=Thermothelomyces thermophilus OX=78579 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000416	0.113171	0.886015	0.000146	0.000126	0.000109

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003601_00840.