CAZyme Information: MGYG000003601_01241

Basic Information

• Species: HGM12713 sp900770605
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-272; HGM12713; HGM12713 sp900770605
• CAZyme ID: MGYG000003601_01241
• CAZy Family: CE14
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
223	MGYG000003601_136|CGC1	24565.82	6.217

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003601	1391946	MAG	Fiji	Oceania

• Gene Location: Start: 27833; End: 28504 Strand: -

Full Sequence      

MKYLVVVAHPDDEVLGAGATIHKLINEGHSVAVCTMANHAAARANISATLTDDQNKALAI
IGVTKCYAADFPNIKMNTVPHLDLVQFVEKCIEDFGAEAIITHHPSDTNNDHVQTSYAVQ
AASRLFQRKPNVPALKQLLYMEVVSSTEWSFDSSANRFTPNFFVEIGKDGVDVKLQALAE
YKGVMRDYPHPRSTEAIYGLAAYRGVQAGCNYAEAFECVFRRD

Enzyme Prediction     

No EC number prediction in MGYG000003601_01241.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE14	4	107	9.7e-18	0.9596774193548387

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2120	LmbE	2.72e-26	1	223	11	232	N-acetylglucosaminyl deacetylase, LmbE family [Carbohydrate transport and metabolism].
pfam02585	PIG-L	2.13e-20	5	120	1	125	GlcNAc-PI de-N-acetylase. Members of this family are related to PIG-L an N-acetylglucosaminylphosphatidylinositol de-N-acetylase (EC:3.5.1.89) that catalyzes the second step in GPI biosynthesis.
PRK02122	PRK02122	0.003	9	33	378	402	glucosamine-6-phosphate deaminase-like protein; Validated

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHG90496.1	7.28e-21	1	221	1	212
ACV67908.1	1.14e-18	6	216	346	561
QNM09796.1	3.19e-14	1	216	1	218
ATZ07896.1	2.32e-10	4	222	9	222
AYH39662.1	1.42e-09	1	217	1	227

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WE7_A	1.19e-06	2	217	37	256	CrystalStructure of Diacetylchitobiose Deacetylase from Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3WE7_B Crystal Structure of Diacetylchitobiose Deacetylase from Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3WE7_C Crystal Structure of Diacetylchitobiose Deacetylase from Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3WL3_A N,N'-diacetylchitobiose deacetylase from Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3WL3_B N,N'-diacetylchitobiose deacetylase from Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3WL3_C N,N'-diacetylchitobiose deacetylase from Pyrococcus horikoshii [Pyrococcus horikoshii OT3],5B2E_A N,N'-diacetylchitobiose deacetylase from Pyrococcus horikoshii complexed with its inhibitor MPG (acetate-containing condition) [Pyrococcus horikoshii OT3],5B2E_B N,N'-diacetylchitobiose deacetylase from Pyrococcus horikoshii complexed with its inhibitor MPG (acetate-containing condition) [Pyrococcus horikoshii OT3],5B2E_C N,N'-diacetylchitobiose deacetylase from Pyrococcus horikoshii complexed with its inhibitor MPG (acetate-containing condition) [Pyrococcus horikoshii OT3],5B2F_A N,N'-diacetylchitobiose deacetylase from Pyrococcus horikoshii complexed with its inhibitor MPG (phosphate-containing condition) [Pyrococcus horikoshii OT3],5B2F_B N,N'-diacetylchitobiose deacetylase from Pyrococcus horikoshii complexed with its inhibitor MPG (phosphate-containing condition) [Pyrococcus horikoshii OT3],5B2F_C N,N'-diacetylchitobiose deacetylase from Pyrococcus horikoshii complexed with its inhibitor MPG (phosphate-containing condition) [Pyrococcus horikoshii OT3]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000007	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003601_01241.