CAZyme Information: MGYG000003603_01143

Basic Information

• Species: UBA3388 sp002358835
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; P3; UBA3388; UBA3388 sp002358835
• CAZyme ID: MGYG000003603_01143
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
243		27734.11	6.3491

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003603	1899995	MAG	Fiji	Oceania

• Gene Location: Start: 6485; End: 7216 Strand: -

Full Sequence      

MKKVLDKLFVILPFEKPFYDKHSMEVEYPGNPLLDEISHYSATQNKEEFLKEHNLGAKPI
IALLPGSRTQEIKKMLPLQLSLVEKFPEFDFVVAGVSTHSPEFYSQYMEDSNAKLIYNNT
YSILNSSHAAIVTSGTATLETALFNVPEVVCYKANPLSFILGKYLVKIRFISLVNLILDS
PVVVELLQDLCNRDDLEKEFRKITFDENNRVEMRYMFGKLRNILGNAGASANIAKYIVED
LRK

Enzyme Prediction     

No EC number prediction in MGYG000003603_01143.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	1	223	8.7e-65	0.6299435028248588

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0763	LpxB	7.84e-60	1	243	133	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
PRK00025	lpxB	1.63e-56	1	243	131	377	lipid-A-disaccharide synthase; Reviewed
pfam02684	LpxB	2.37e-45	3	191	132	326	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	2.52e-38	3	239	137	384	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	1.14e-34	1	237	124	344	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFD07892.1	2.66e-74	1	241	130	367
QEE49237.1	7.74e-74	1	243	130	371
SDS31336.1	1.17e-72	1	242	130	369
VEH64871.1	3.80e-72	1	242	130	370
ADX67507.1	3.80e-72	1	242	130	370

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	2.86e-18	3	196	138	337	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	3.91e-18	3	196	138	337	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B6J161	5.81e-35	1	237	133	370	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuG_Q212) OX=434923 GN=lpxB PE=3 SV=1
B6J9H1	8.12e-35	1	237	133	370	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuK_Q154) OX=434924 GN=lpxB PE=3 SV=1
A9KC41	8.12e-35	1	237	133	370	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain Dugway 5J108-111) OX=434922 GN=lpxB PE=3 SV=1
Q83DS5	1.13e-34	1	237	133	370	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) OX=227377 GN=lpxB PE=3 SV=1
A9NCA7	1.13e-34	1	237	133	370	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) OX=360115 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003603_01143.