CAZyme Information: MGYG000003604_00161

Basic Information

• Species: Alistipes sp900770585
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp900770585
• CAZyme ID: MGYG000003604_00161
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
235		26873.79	10.2818

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003604	1572375	MAG	Fiji	Oceania

• Gene Location: Start: 1230; End: 1937 Strand: -

Full Sequence      

MFVLSIALTAVYRWVNPPITLLMISRALNGADINKKWVPLDEISPNLVRASIASEDNNYL
GHRGFDLGAIYDAIDERNSGKRQRGASTISQQTAKNVFLWSGKSWIRKGLEVYFTFLIEH
IWGKERIMEVYLNVIEMGNGVYGAEAAAQHYFGRSSSKLTQRQAALIVAAYPNPRQRDPA
HPTRYLNKRASQIQRLMPLMGTIAFDEECIAEARERYDRYVDNRKAAHKRKQNKK

Enzyme Prediction     

No EC number prediction in MGYG000003604_00161.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	32	197	9.4e-53	0.9378531073446328

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00056	mtgA	9.43e-111	1	201	19	227	monofunctional biosynthetic peptidoglycan transglycosylase; Provisional
TIGR02070	mono_pep_trsgly	8.85e-84	5	197	18	218	monofunctional biosynthetic peptidoglycan transglycosylase. This family is one of the transglycosylases involved in the late stages of peptidoglycan biosynthesis. Members tend to be small, about 240 amino acids in length, and consist almost entirely of a domain described by pfam00912 for transglycosylases. Species with this protein will have several other transglycosylases as well. All species with this protein are Proteobacteria that produce murein (peptidoglycan). [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	1.09e-65	1	223	34	277	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	4.64e-62	34	197	12	176	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
TIGR02074	PBP_1a_fam	9.66e-44	34	234	1	197	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAI73049.1	3.28e-73	5	200	19	214
ACU02964.1	3.42e-72	5	205	15	221
ATP58907.1	9.52e-72	11	205	42	242
QEL00846.1	2.46e-71	11	197	62	254
QBR12169.1	4.50e-71	2	197	39	240

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NB6_A	6.30e-29	37	197	22	184	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
2OQO_A	8.86e-29	37	197	22	184	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
4OON_A	4.84e-22	32	199	36	205	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
5U2G_A	1.22e-21	38	193	43	199	2.6Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20],5U2G_B 2.6 Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20]
3UDF_A	2.85e-19	35	199	37	205	ChainA, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDF_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q3V815	9.13e-67	2	200	18	222	Biosynthetic peptidoglycan transglycosylase OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=mtgA PE=3 SV=1
Q3V7G2	9.13e-67	2	200	18	222	Biosynthetic peptidoglycan transglycosylase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / NCTC 9343 / Onslow) OX=272559 GN=mtgA PE=3 SV=1
Q9ABA6	1.16e-65	12	193	31	212	Biosynthetic peptidoglycan transglycosylase OS=Caulobacter vibrioides (strain ATCC 19089 / CB15) OX=190650 GN=mtgA PE=3 SV=1
B8GYX9	1.16e-65	12	193	31	212	Biosynthetic peptidoglycan transglycosylase OS=Caulobacter vibrioides (strain NA1000 / CB15N) OX=565050 GN=mtgA PE=3 SV=1
B6IWJ6	1.62e-63	4	200	21	218	Biosynthetic peptidoglycan transglycosylase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) OX=414684 GN=mtgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.996385	0.003482	0.000123	0.000007	0.000003	0.000009

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003604_00161.