CAZyme Information: MGYG000003605.1_00953

Basic Information

• Species: Alistipes sp900770635
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp900770635
• CAZyme ID: MGYG000003605.1_00953
• CAZy Family: GH171
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
388	MGYG000003605.1_99|CGC2	43582.1	6.4275

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003605.1	2259375	MAG	Fiji	Oceania

• Gene Location: Start: 90059; End: 91225 Strand: -

Full Sequence      

MLRALLLFVVTVMTSVSVMANGDGEVLVGATDTAQYMPLLRGRRVAVLANHTAMYSKEEH
IVDMMHREGITLAGIFAPEHGFRGSIEAGVVVKNSVDERTGVPILSLYTGNKKRPSDEVM
RSFDVLVVDMQDVGLRFYTYYITMLQIMDACADFGQKVIVLDRPNPNGHYVDGPILDMRY
KSGVGWLPIPVVHGLTMGEIATMAVGEGWARYVDLTVIKCRNYDHSTHYTLPVAPSPNLP
TQHSIYLYPSTCLFEGTVLSMGRGTEAPFEIYGHPDMRGYDFNFTPVPNAGSKTPPHNGV
RCYGVDLRGVSDEQIWQNGVNIEYLVDAYRNLNIGEQFFKPIFEKLIGVDYVRQMIIDGC
SAQEIKARWKSDVEKFKEQRKRYLLYAE

Enzyme Prediction     

No EC number prediction in MGYG000003605.1_00953.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH171	45	386	2.2e-111	0.9971830985915493

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07075	DUF1343	2.11e-160	46	386	1	362	Protein of unknown function (DUF1343). This family consists of several hypothetical bacterial proteins of around 400 residues in length. The function of this family is unknown.
COG3876	YbbC	3.05e-89	35	386	36	409	Uncharacterized conserved protein YbbC, DUF1343 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBL14966.1	1.74e-183	2	386	1	390
BBL02893.1	1.16e-181	2	386	1	390
QIK60899.1	1.95e-177	25	388	24	389
QIK55482.1	1.59e-176	25	388	24	389
BBL01800.1	3.99e-176	8	386	4	404

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4JJA_A	4.81e-163	25	386	5	368	Crystalstructure of a DUF1343 family protein (BF0379) from Bacteroides fragilis NCTC 9343 at 1.30 A resolution [Bacteroides fragilis NCTC 9343]
4K05_A	3.10e-40	35	386	23	398	Crystalstructure of a DUF1343 family protein (BF0371) from Bacteroides fragilis NCTC 9343 at 1.65 A resolution [Bacteroides fragilis NCTC 9343],4K05_B Crystal structure of a DUF1343 family protein (BF0371) from Bacteroides fragilis NCTC 9343 at 1.65 A resolution [Bacteroides fragilis NCTC 9343]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40407	9.93e-71	36	386	48	414	Uncharacterized protein YbbC OS=Bacillus subtilis (strain 168) OX=224308 GN=ybbC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000222	0.999102	0.000161	0.000164	0.000152	0.000141

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003605.1_00953.