CAZyme Information: MGYG000003606_01507

Basic Information

• Species: HGM10611 sp900770645
• Lineage: Bacteria; Firmicutes; Bacilli; ML615J-28; CAG-313; HGM10611; HGM10611 sp900770645
• CAZyme ID: MGYG000003606_01507
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
669	MGYG000003606_232|CGC1	74376.63	4.7822

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003606	1568287	MAG	Fiji	Oceania

• Gene Location: Start: 6992; End: 9001 Strand: -

Full Sequence      

MEPRDITLVAKWKKVDHTVTLDLDGGTLDSKYLTQTIEHNGYAVLLNPTKKDYVFLGWYD
GKTLYDSTTPITSDVELTAKWDLASNYDTTYSISYELNGGKLLSTKNSYTVGKETSLGTP
TKEGCLFLGWYEKEDFSGLKVEKITSSEYGDKKYYAYFVNQNENFNVTFLDSEGNVVTTK
EVKYGETVEKEKLEAEAYFEFSWYLGNKIFDFDTPITKDITLCAKWTILSDILQDLVPNR
TKDNLDLPKSLNTSLGDITISWLSSDKTVISPQGIVNPLREDTVITLTATISCGKSSFVH
KVDVIVDSVVMRDLSKTTPVFAYLYSNMGSYDGMNGVSEQTIDVINYCFARVSNDGIVIM
SELTKTSVVIEARKQGIRVLYSIGAYGSGDDDPTKCGNFSKAASTPEGRKKLIDSIIKII
VNNHFDGVDIDWEYPGSFPATGISPAEDRGNYGLFMRELRKALDDLGPGYLLTAAIPGGD
NPSSRYDMKMLDEVLDYMHIMSYDLHNSSRTCHHTALYSSNNTPYGSVDSSVKSFVKAGF
PKSKIVIGAAFYGRVWKLSSNPGVPMGATNVVSSGENETFTSIKQSYIGKSTVRTYWDSV
SHAPYLYDSATKTFISYDNETSLIYKCKYLRDNDLAGIMFWDYGEDLTRSLVTAIGTALG
KIEDESNVG

Enzyme Prediction     

EC	3.2.1.14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	337	650	1.1e-69	0.8648648648648649

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06548	GH18_chitinase	4.06e-80	320	646	1	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
smart00636	Glyco_18	2.57e-75	320	642	2	330	Glyco_18 domain.
pfam00704	Glyco_hydro_18	1.68e-70	320	646	2	307	Glycosyl hydrolases family 18.
cd02872	GH18_chitolectin_chitotriosidase	4.20e-60	345	641	31	336	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.
COG3325	ChiA	4.20e-57	320	660	40	437	Chitinase, GH18 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUS97898.1	1.53e-61	345	652	35	340
QOT09650.1	3.65e-59	328	659	8	342
AYB47558.1	1.91e-58	328	655	8	338
ACX68259.1	3.70e-58	328	659	8	342
QAV17545.1	4.78e-57	345	667	30	350

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6INX_A	3.80e-56	345	655	30	338	Structuralinsights into a novel glycoside hydrolase family 18 N-acetylglucosaminidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii]
5GZU_A	5.41e-43	337	655	532	877	CrystalStructure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZU_B Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZV_A Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZV_B Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7]
5GZT_B	8.08e-43	337	655	783	1128	CrystalStructure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7]
6KXN_A	4.90e-40	320	659	9	370	Crystalstructure of W50A mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXN_B Crystal structure of W50A mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]
6KST_A	4.90e-40	320	659	9	370	Crystalstructure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KST_B Crystal structure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KXL_A Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXL_B Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A6N6J0	1.46e-33	370	668	116	414	Endochitinase 46 OS=Trichoderma harzianum OX=5544 GN=chit46 PE=1 SV=1
P48827	8.13e-33	370	668	115	407	Endochitinase 42 OS=Trichoderma harzianum OX=5544 GN=chit42 PE=1 SV=1
P20533	2.04e-31	377	651	155	443	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
Q873X9	2.23e-30	365	660	116	405	Endochitinase B1 OS=Neosartorya fumigata OX=746128 GN=chiB1 PE=1 SV=1
E9QRF2	2.23e-30	365	660	116	405	Endochitinase B1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=chiB1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003606_01507.