CAZyme Information: MGYG000003607_00643

Basic Information

• Species: HGM04593 sp900770655
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; HGM04593; HGM04593 sp900770655
• CAZyme ID: MGYG000003607_00643
• CAZy Family: CE1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
287		32568.02	4.6908

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003607	1908641	MAG	Fiji	Oceania

• Gene Location: Start: 42405; End: 43268 Strand: +

Full Sequence      

MKRIFIALFLLAATFQLLPAQGVSAYPAVVECEMDSRILGCTKKYCVYLPAGYGCEEREF
PVLYLLHGLTDTHTAWRDKGNVQEIATEIFAVGEAVEMVIVMPDAGTTFDGYFNVEGWLY
EDFFFQEFIPHVESEFRIVGDREHRAIAGLSMGGGGTTHYAMTHSGMFSSAYAMSALMGL
VENSWISYAPDARRRAFMRSIVDNSNIEHLKNAADEECRDIASVRWFIDVGDDDFLFENN
MDFVCEMRRKHIPYQLRVRDGGHTWQYWQEALGMALTFISEGFGAKQ

Enzyme Prediction     

No EC number prediction in MGYG000003607_00643.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	36	278	3.1e-53	0.973568281938326

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0627	FrmB	9.17e-31	47	285	39	314	S-formylglutathione hydrolase FrmB [Defense mechanisms].
pfam00756	Esterase	4.75e-25	36	272	1	239	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG2382	Fes	6.59e-23	35	278	75	294	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
COG2819	YbbA	4.69e-09	24	175	4	169	Predicted hydrolase of the alpha/beta superfamily [General function prediction only].
PLN02442	PLN02442	1.48e-05	35	156	24	156	S-formylglutathione hydrolase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEH32729.1	2.07e-31	28	269	148	384
SCD19884.1	1.28e-26	42	279	156	388
AYQ33230.1	1.86e-26	42	265	147	356
QNA46491.1	2.10e-26	35	265	138	342
QHT67364.1	2.35e-26	35	272	155	380

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5VOL_A	4.66e-82	29	284	12	273	Bacint_04212ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_B Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_C Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_D Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_E Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_F Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_G Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_H Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393]
6RZN_A	1.46e-25	29	269	132	374	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium],6RZN_B Crystal structure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
4RGY_A	6.02e-20	28	279	3	261	Structuraland functional analysis of a low-temperature-active alkaline esterase from South China Sea marine sediment microbial metagenomic library [uncultured bacterium FLS12],4RGY_B Structural and functional analysis of a low-temperature-active alkaline esterase from South China Sea marine sediment microbial metagenomic library [uncultured bacterium FLS12]
7L0A_A	1.30e-18	25	279	7	258	ChainA, Esterase family protein [Staphylococcus aureus],7L0A_B Chain B, Esterase family protein [Staphylococcus aureus]
6VH9_A	1.63e-18	28	279	4	252	FphF,Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, apo form [Staphylococcus aureus],6VH9_B FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, apo form [Staphylococcus aureus],6VH9_C FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, apo form [Staphylococcus aureus],6VH9_D FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, apo form [Staphylococcus aureus],6VHD_A FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT129 bound [Staphylococcus aureus],6VHD_B FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT129 bound [Staphylococcus aureus],6VHD_C FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT129 bound [Staphylococcus aureus],6VHD_D FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT129 bound [Staphylococcus aureus],6VHE_A FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT130 bound [Staphylococcus aureus],6VHE_B FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT130 bound [Staphylococcus aureus],6VHE_C FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT130 bound [Staphylococcus aureus],6VHE_D FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT130 bound [Staphylococcus aureus],6WCX_A FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound [Staphylococcus aureus],6WCX_B FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound [Staphylococcus aureus],6WCX_C FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound [Staphylococcus aureus],6WCX_D FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound [Staphylococcus aureus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P10478	1.04e-16	29	235	51	262	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
D5EXZ4	2.57e-15	47	272	449	661	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1
D5EY13	2.03e-10	47	168	518	646	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1
P31471	8.36e-10	25	154	139	282	Uncharacterized protein YieL OS=Escherichia coli (strain K12) OX=83333 GN=yieL PE=4 SV=3
P9WM38	1.71e-09	47	175	192	318	Esterase MT1326 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT1326 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000201	0.999193	0.000152	0.000154	0.000142	0.000136

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003607_00643.